|
||||||
|
UniGene Name: sp_v3.0_unigene65651
Length: 138 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene65651
C |
|
Ace file of the UniGene sp_v3.0_unigene65651
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Dihydrolipoyl dehydrogenase n=2 Tax=Picea sitchensis RepID=B8LLJ4_PICSI | - | - | 1.0e-09 | 80% |
| FL-Next | sp=Dihydrolipoyl dehydrogenase; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 80% |
| Sma3 | Dihydrolipoyl dehydrogenase | - | - | 3.245e-07 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Dihydrolipoyl dehydrogenase. | EC:1.8.1.4 | - | 4.029e-07 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glycolysis / Gluconeogenesis | 00010 | 4.029e-07 | % | |
| Sma3 | Citrate cycle (TCA cycle) | 00020 | 4.029e-07 | % | |
| Sma3 | Glycine, serine and threonine metabolism | 00260 | 4.029e-07 | % | |
| Sma3 | Valine, leucine and isoleucine degradation | 00280 | 4.029e-07 | % | |
| Sma3 | Pyruvate metabolism | 00620 | 4.029e-07 | % | |
| Sma3 | Biosynthesis of phenylpropanoids | 01061 | 4.029e-07 | % | |
| Sma3 | Biosynthesis of terpenoids and steroids | 01062 | 4.029e-07 | % | |
| Sma3 | Biosynthesis of alkaloids derived from shikimate pathway | 01063 | 4.029e-07 | % | |
| Sma3 | Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid | 01064 | 4.029e-07 | % | |
| Sma3 | Biosynthesis of alkaloids derived from histidine and purine | 01065 | 4.029e-07 | % | |
| Sma3 | Biosynthesis of alkaloids derived from terpenoid and polyketide | 01066 | 4.029e-07 | % | |
| Sma3 | Biosynthesis of plant hormones | 01070 | 4.029e-07 | % | |
| Sma3 | Metabolic pathways | 01100 | 4.029e-07 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 4.029e-07 | % |
| Source | Gene names |
|---|---|
| Sma3 | DLDH; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | dihydrolipoyl dehydrogenase activity | GO:0004148 | Molecular Function | 0.0 | - |
| Sma3 | flavin adenine dinucleotide binding | GO:0050660 | Molecular Function | 0.0 | - |
| Sma3 | cell redox homeostasis | GO:0045454 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Mercuric reductase | IPR000815 | - | 0.0 | - |
| Sma3 | Pyridine nucleotide-disulphide oxidoreductase, NAD-binding domain | IPR001327 | - | 0.0 | - |
| Sma3 | Pyridine nucleotide-disulphide oxidoreductase, dimerisation | IPR004099 | - | 0.0 | - |
| Sma3 | Dihydrolipoamide dehydrogenase | IPR006258 | - | 0.0 | - |
| Sma3 | Pyridine nucleotide-disulphide oxidoreductase, class I, active site | IPR012999 | - | 0.0 | - |
| Sma3 | FAD-dependent pyridine nucleotide-disulphide oxidoreductase | IPR013027 | - | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LQQ4
Fln msg: Distance to subject end: 367 aas, your sequence is shorter than subject: 45 - 502
Fln protein:
S
Protein Length:
46
Fln nts:
C
Fln Alignment:
GFXCM5X02FVFUG___SKALLHSSHMFMKPKLYAFAGHGVKVGQVEIDIPAMMAQERK
B8LQQ4_______________SKALLQSSHMFYEAK-HAFAGHGVKVGQVEIDIPAMMAQKEK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
