|
||||||
|
UniGene Name: sp_v3.0_unigene65650
Length: 234 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene65650
T |
|
Ace file of the UniGene sp_v3.0_unigene65650
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Nucleoside diphosphate kinase n=1 Tax=Pinus pinaster RepID=Q8RVI6_PINPS | - | - | 3.0e-27 | 96% |
| FL-Next | sp=Nucleoside diphosphate kinase; Pinus pinaster (Maritime pine). | - | - | 0.0 | 85% |
| Sma3 | Nucleoside diphosphate kinase | - | - | 4.439e-25 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Nucleoside-diphosphate kinase. | EC:2.7.4.6 | - | 3.767e-36 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Purine metabolism | 00230 | 3.767e-36 | % | |
| Sma3 | Pyrimidine metabolism | 00240 | 3.767e-36 | % | |
| Sma3 | Metabolic pathways | 01100 | 3.767e-36 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 3.767e-36 | % |
| Source | Gene names |
|---|---|
| Sma3 | AT4G11010; At4g11010; At4g23900; Bc-NDPK3; BcNDK III; F25I24.220; F8M12.12; GSVIVT00006748001; NDK4; NDPK3; NDPK3a; NDPK3b; NDPKIII; PHYPADRAFT_55603; PHYPADRAFT_60721; PNDK3; POPTRDRAFT_554495; POPTRDRAFT_640355; RCOM_1692110; RPNDK3; T32A16.70; VITISV_0 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | mitochondrial inner membrane | GO:0005743 | Cellular Component | 0.0 | - |
| Sma3 | mitochondrial intermembrane space | GO:0005758 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | thylakoid | GO:0009579 | Cellular Component | 0.0 | - |
| Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
| Sma3 | nucleoside diphosphate kinase activity | GO:0004550 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | GTP biosynthetic process | GO:0006183 | Biological Process | 0.0 | - |
| Sma3 | UTP biosynthetic process | GO:0006228 | Biological Process | 0.0 | - |
| Sma3 | CTP biosynthetic process | GO:0006241 | Biological Process | 0.0 | - |
| Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Nucleoside diphosphate kinase | IPR001564 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G23900.1 | Nucleoside diphosphate kinase family protein chr4:12424505-12426318 FORWARD LENGTH=237 | 3.0e-24 | 78% |
| RefSeq | Arabidopsis thaliana | NP_001190817.1 | Pleckstrin homology (PH) domain-containing protein [Arabidopsis thaliana] | 4.0e-24 | 78% |
| RefSeq | Populus trichocarpa | XP_002299472.1 | predicted protein [Populus trichocarpa] | 3.0e-25 | 81% |
| Full-Lengther Next Prediction |
|---|
Fln status: Putative C-terminus
Fln database: coniferopsida.fasta
Fln subject: Q8RVI6
Fln msg: Separated hits, possible frame ERROR between 64 and 66, and possible frame ERROR between 134 and 136, STOP codon was not found. Distance to subject end: 6 aas, your sequence is shorter than subject: 79 - 235
Fln protein:
G
Protein Length:
80
Fln nts:
T
Fln Alignment:
GFXCM5X02JPCY2___GPVLAMVWEGQGVIKYGRQTLxIGATDPQNSEPGTIRGDLAIIVGxDIIHGSDGPETAKNEINLWFKPEELVNYAHNSE
Q8RVI6_______________GPVLAMVWEGQGVIKYGRKLIxIGATDPQNSEPGTIRGDLAIIVGxNIIHGSDGPETAKNEINLWFKPEELVNYAHNSE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
