UniGene Name: sp_v3.0_unigene65629
Length: 202 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene65629
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | RecName: Full=ATP-dependent Clp protease ATP-binding subunit clpA homolog CD4A, chloroplastic; Flags: Precursor gb|AAA34160.1| ATP-dependent protease (CD4A) [Solanum lycopersicum] | - | - | 4.0e-21 | 92% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 90% |
Sma3 | ATP-dependent Clp protease ATP-binding subunit clpA CD4B,chloroplast, putative, expressed | - | - | 1.141e-11 | - |
Source | Gene names |
---|---|
Sma3 | At3g48870; At5g50920; AtclpC; CD4A; CD4B; CLPA; CLPC1; GSVIVT00018028001; Grc000058; LOC_Os11g16590; LOC_Os11g16770; LOC_Os12g12850; MICPUCDRAFT_44966; MICPUN_92311; OSJNBa0039C07.4; OSTLU_29402; Os04g0397100; Os11g0267400; Os12g0230100; OsI_15715; OsI_35 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | chloroplast thylakoid membrane | GO:0009535 | Cellular Component | 0.0 | - |
Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
Sma3 | Tic complex | GO:0031897 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | ATP-dependent peptidase activity | GO:0004176 | Molecular Function | 0.0 | - |
Sma3 | nuclease activity | GO:0004518 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | peptidase activity | GO:0008233 | Molecular Function | 0.0 | - |
Sma3 | nucleoside-triphosphatase activity | GO:0017111 | Molecular Function | 0.0 | - |
Sma3 | nucleotide-excision repair | GO:0006289 | Biological Process | 0.0 | - |
Sma3 | chloroplast organization | GO:0009658 | Biological Process | 0.0 | - |
Sma3 | regulation of chlorophyll biosynthetic process | GO:0010380 | Biological Process | 0.0 | - |
Sma3 | protein metabolic process | GO:0019538 | Biological Process | 0.0 | - |
Sma3 | protein import into chloroplast stroma | GO:0045037 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Chaperonin ClpA/B | IPR001270 | - | 0.0 | - |
Sma3 | UVR domain | IPR001943 | - | 0.0 | - |
Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
Sma3 | ATPase, AAA-type, core | IPR003959 | - | 0.0 | - |
Sma3 | Clp, N-terminal | IPR004176 | - | 0.0 | - |
Sma3 | ATPase, AAA-2 | IPR013093 | - | 0.0 | - |
Sma3 | Chaperonin ClpA/B, conserved site | IPR018368 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G50920.1 | CLPC, ATHSP93-V, HSP93-V, DCA1, CLPC1 CLPC homologue 1 chr5:20715710-20719800 REVERSE LENGTH=929 | 2.0e-22 | 86% |
RefSeq | Arabidopsis thaliana | NP_568746.1 | ATP-dependent Clp protease ATP-binding subunit ClpC [Arabidopsis thaliana] | 3.0e-22 | 86% |
RefSeq | Populus trichocarpa | XP_002322299.1 | predicted protein [Populus trichocarpa] | 1.0e-22 | 86% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5AEG2
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 17 aas, your sequence is shorter than subject: 59 - 323
Fln protein:
D
Protein Length:
60
Fln nts:
G
Fln Alignment:
GFXCM5X02JI5TA___DIDLQVTERFRDRVVDEGYSPSYGARPLRRAIMRLLEDCMAEKMLAGEIKE
D5AEG2_______________EIGLQVTERFTDRVVDEGYSPSYGARPLRRAIMRLLEDSLAEKMLAGEIKE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain