UniGene Name: sp_v3.0_unigene65581
Length: 176 nt
UniGene Fasta |
---|
>sp_v3.0_unigene65581
G |
Ace file of the UniGene sp_v3.0_unigene65581 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Alcohol dehydrogenase n=1 Tax=Pinus pinaster RepID=F4MKM2_PINPS | - | - | 4.0e-25 | 96% |
FL-Next | tr=Alcohol dehydrogenase; Pinus pinaster (Maritime pine). | - | - | 0.0 | 96% |
Sma3 | Alcohol dehydrogenase | - | - | 6.215e-29 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Alcohol dehydrogenase. | EC:1.1.1.1 | - | 1.4013e-45 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Glycolysis / Gluconeogenesis | 00010 | 1.4013e-45 | % | |
Sma3 | Fatty acid metabolism | 00071 | 1.4013e-45 | % | |
Sma3 | Glycine, serine and threonine metabolism | 00260 | 1.4013e-45 | % | |
Sma3 | Tyrosine metabolism | 00350 | 1.4013e-45 | % | |
Sma3 | Chloroalkane and chloroalkene degradation | 00625 | 1.4013e-45 | % | |
Sma3 | Naphthalene degradation | 00626 | 1.4013e-45 | % | |
Sma3 | Retinol metabolism | 00830 | 1.4013e-45 | % | |
Sma3 | Metabolism of xenobiotics by cytochrome P450 | 00980 | 1.4013e-45 | % | |
Sma3 | Drug metabolism - cytochrome P450 | 00982 | 1.4013e-45 | % | |
Sma3 | Metabolic pathways | 01100 | 1.4013e-45 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 1.4013e-45 | % |
Source | Gene names |
---|---|
Sma3 | ADH; ADH1; ADH2; ADH3; ADH6; Adh; Adh1; Adh1A; Adh1B; Adh1a; Adh2; Adh2d; AdhC2; AdhC3; AdhC4; AdhC5; AdhC7; AdhD; AdhE; Amadh; GSVIVT00014300001; GSVIVT00014303001; GSVIVT00034832001; GSVIVT00034833001; GSVIVT00034834001; GV-ADH1; POPTRDRAFT_558388; POPT |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | alcohol dehydrogenase (NAD) activity | GO:0004022 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Alcohol dehydrogenase superfamily, zinc-type | IPR002085 | - | 0.0 | - |
Sma3 | Alcohol dehydrogenase, zinc-type, conserved site | IPR002328 | - | 0.0 | - |
Sma3 | Alcohol dehydrogenase, C-terminal | IPR013149 | - | 0.0 | - |
Sma3 | Alcohol dehydrogenase GroES-like | IPR013154 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G77120.1 | ADH1, ADH, ATADH, ATADH1 alcohol dehydrogenase 1 chr1:28975509-28977216 FORWARD LENGTH=379 | 5.0e-26 | 79% |
RefSeq | Arabidopsis thaliana | NP_177837.1 | alcohol dehydrogenase class-P [Arabidopsis thaliana] | 7.0e-26 | 79% |
RefSeq | Populus trichocarpa | XP_002309900.1 | predicted protein [Populus trichocarpa] | 2.0e-29 | 86% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: F4MKM2
Fln msg: Distance to subject end: 248 aas, your sequence is shorter than subject: 58 - 449
Fln protein:
V
Protein Length:
59
Fln nts:
G
Fln Alignment:
GFXCM5X02GQBM2___VVESVGEGVTHLKPGDKVPFPVFTGECRECRHCKSEESNMCDLLRINTERGVMINDGK
F4MKM2_______________VVESVGEGVTHLKPGDKV-LPVFTGECRECRHCKSEESNMCDLLRINTERGVMINDGK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain