|
||||||
|
UniGene Name: sp_v3.0_unigene65511
Length: 208 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene65511
G |
|
Ace file of the UniGene sp_v3.0_unigene65511
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | heat shock like protein [Arabidopsis thaliana] | - | - | 2.0e-30 | 97% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 57% |
| Sma3 | GRP94 homolog | - | - | 7.519e-12 | - |
| Source | Gene names |
|---|---|
| Sma3 | At2g04030; At3g07770; At4g24190; CHLREDRAFT_154398; F17A17.11; GSVIVT00014401001; GSVIVT00021159001; GSVIVT00029132001; HSP90; HSP90-7; HSP90B; HSP90C; MICPUCDRAFT_14003; MICPUCDRAFT_49037; MICPUN_106749; MICPUN_55581; MICPUN_62210; MLP3.22; OJ1540_H01.1; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
| Sma3 | endoplasmic reticulum lumen | GO:0005788 | Cellular Component | 0.0 | - |
| Sma3 | ribosome | GO:0005840 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
| Sma3 | structural constituent of ribosome | GO:0003735 | Molecular Function | 0.0 | - |
| Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | unfolded protein binding | GO:0051082 | Molecular Function | 0.0 | - |
| Sma3 | translation | GO:0006412 | Biological Process | 0.0 | - |
| Sma3 | protein folding | GO:0006457 | Biological Process | 0.0 | - |
| Sma3 | response to stress | GO:0006950 | Biological Process | 0.0 | - |
| Sma3 | protein secretion | GO:0009306 | Biological Process | 0.0 | - |
| Sma3 | response to cold | GO:0009409 | Biological Process | 0.0 | - |
| Sma3 | response to water deprivation | GO:0009414 | Biological Process | 0.0 | - |
| Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
| Sma3 | regulation of meristem structural organization | GO:0009934 | Biological Process | 0.0 | - |
| Sma3 | regulation of meristem growth | GO:0010075 | Biological Process | 0.0 | - |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ribosomal protein L28 | IPR001383 | - | 0.0 | - |
| Sma3 | Heat shock protein Hsp90 | IPR001404 | - | 0.0 | - |
| Sma3 | Sterile alpha motif domain | IPR001660 | - | 0.0 | - |
| Sma3 | ATPase-like, ATP-binding domain | IPR003594 | - | 0.0 | - |
| Sma3 | Sterile alpha motif, type 2 | IPR011510 | - | 0.0 | - |
| Sma3 | Molecular chaperone, heat shock protein, endoplasmin | IPR015566 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G04030.1 | CR88, EMB1956, HSP90.5, Hsp88.1, AtHsp90.5 Chaperone protein htpG family protein chr2:1281983-1285909 FORWARD LENGTH=780 | 1.0e-37 | 97% |
| RefSeq | Arabidopsis thaliana | NP_849932.1 | Chaperone protein htpG family protein [Arabidopsis thaliana] | 1.0e-37 | 97% |
| RefSeq | Populus trichocarpa | XP_002315997.1 | predicted protein [Populus trichocarpa] | 7.0e-38 | 97% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NUB7
Fln msg: Distance to subject end: 108 aas, your sequence is shorter than subject: 69 - 466
Fln protein:
G
Protein Length:
70
Fln nts:
G
Fln Alignment:
GFXCM5X02H4VDY___VAKVQVSKRLSSSPCVLVSGKFGWSANMERLMKAQTLGDTSSLEFMRGRRILEINPDHPIIKDL
A9NUB7_______________VDSVKISNRLDNTPGVVVTSKYGWSANMERIMQSQTLSDANRQSYMRGKRVLEINPRHPIIKEL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
