UniGene Name: sp_v3.0_unigene65458
Length: 215 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene65458
C |
Ace file of the UniGene sp_v3.0_unigene65458
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | hydroxyphenylpyruvate dioxygenase [Coptis japonica var. dissecta] | - | - | 3.0e-23 | 87% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 92% |
| Sma3 | 4-hydroxyphenylpyruvate dioxygenase | - | - | 4.2039e-45 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | 4-hydroxyphenylpyruvate dioxygenase. | EC:1.13.11.27 | - | 2.149e-30 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ubiquinone and other terpenoid-quinone biosynthesis | 00130 | 2.149e-30 | % | |
| Sma3 | Tyrosine metabolism | 00350 | 2.149e-30 | % | |
| Sma3 | Phenylalanine metabolism | 00360 | 2.149e-30 | % | |
| Sma3 | Metabolic pathways | 01100 | 2.149e-30 | % |
| Source | Gene names |
|---|---|
| Sma3 | At1g06570; CHLREDRAFT_149028; GSVIVT00015688001; GSVIVT00018870001; HDP1; HPD; HPD1; HPPD; MICPUCDRAFT_12391; MICPUN_79223; OSJNBa0085K21.52; OSTLU_45212; Os02g0168100; OsI_06005; OsJ_05532; Ot03g03700; P0669G09.6; PHYPADRAFT_178418; PHYPADRAFT_204526; PO |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | cytosol | GO:0005829 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | 4-hydroxyphenylpyruvate dioxygenase activity | GO:0003868 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | L-phenylalanine catabolic process | GO:0006559 | Biological Process | 0.0 | - |
| Sma3 | tyrosine catabolic process | GO:0006572 | Biological Process | 0.0 | - |
| Sma3 | aromatic amino acid family metabolic process | GO:0009072 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Aminoacyl-tRNA synthetase, class I, conserved site | IPR001412 | - | 0.0 | - |
| Sma3 | Glyoxalase/fosfomycin resistance/dioxygenase | IPR004360 | - | 0.0 | - |
| Sma3 | 4-hydroxyphenylpyruvate dioxygenase | IPR005956 | - | 0.0 | - |
| Sma3 | Myb DNA-binding domain, plants | IPR006447 | - | 0.0 | - |
| Sma3 | IPR012287 | - | 0.0 | - | |
| Sma3 | IPR014778 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G06570.1 | PDS1, HPD phytoene desaturation 1 chr1:2012015-2013543 REVERSE LENGTH=473 | 4.0e-28 | 83% |
| RefSeq | Arabidopsis thaliana | NP_001154311.1 | 4-hydroxyphenylpyruvate dioxygenase [Arabidopsis thaliana] | 3.0e-28 | 83% |
| RefSeq | Populus trichocarpa | XP_002300867.1 | predicted protein [Populus trichocarpa] | 3.0e-28 | 84% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9P1M2
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 127 aas, your sequence is shorter than subject: 69 - 263
Fln protein:
R
Protein Length:
70
Fln nts:
C
Fln Alignment:
GFXCM5X02G7USI___RFAEFTAEDVGTTESGLNSDGFCLASNNEMVLLPMNEPVFGTKRKSQIQTYLEHNEGPGLQHLAL
A9P1M2_______________RFAEFTAEDVGTAESGLNS--MVLASNNEMVLLPMNEPVFGTKRKSQIQTYLEHNEGPGLQHLAL

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta