SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene65453

Length: 237 nt

UniGene Fasta

>sp_v3.0_unigene65453
CAGGACAAATATTCCTGGAATTTATGCTATTGGTGATGTGATTCCTCGGTCCCATTTTTGTTTCTTGCACACAAGGCTGAAGAAGATGGCTTTGCCTGTGCAGAGCTTATTGCAGGAAAACCTGGACATGTGGACTATGACACTGTACCTGGAATTGTTTATACACATCCAGAGGTAGCTTCAGTAGGAAAGACAGAGGAGCAGGTCAAGGCTCTGAATACCCCATACAAAGTTGGA

Ace file of the UniGene sp_v3.0_unigene65453

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Dihydrolipoyl dehydrogenase n=2 Tax=Picea sitchensis RepID=B8LLJ4_PICSI	-	-	4.0e-29	88%
FL-Next	sp=Dihydrolipoyl dehydrogenase; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	88%
Sma3	Dihydrolipoyl dehydrogenase	-	-	0.0	-

Source	ECs	Term	Type	e value	Identity
Sma3	Dihydrolipoyl dehydrogenase.	EC:1.8.1.4	-	0.0	-

Source	KEGGs	Term	Identity
Sma3	Glycolysis / Gluconeogenesis	00010	%
Sma3	Citrate cycle (TCA cycle)	00020	%
Sma3	Glycine, serine and threonine metabolism	00260	%
Sma3	Valine, leucine and isoleucine degradation	00280	%
Sma3	Pyruvate metabolism	00620	%
Sma3	Biosynthesis of phenylpropanoids	01061	%
Sma3	Biosynthesis of terpenoids and steroids	01062	%
Sma3	Biosynthesis of alkaloids derived from shikimate pathway	01063	%
Sma3	Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid	01064	%
Sma3	Biosynthesis of alkaloids derived from histidine and purine	01065	%
Sma3	Biosynthesis of alkaloids derived from terpenoid and polyketide	01066	%
Sma3	Biosynthesis of plant hormones	01070	%
Sma3	Metabolic pathways	01100	%
Sma3	Biosynthesis of secondary metabolites	01110	%

Source	Gene names
Sma3	At1g48030; At3g17240; CHLREDRAFT_57890; DLDH; DLDH-GCSL; F21D18.28; GCSL; GSVIVT00019672001; LDH; LPD; LPD1; LPD2; LPD_B273; MGD8.7; MICPUCDRAFT_28757; MICPUN_104984; OSTLU_26614; Os01g0328700; OsI_01694; OsI_13390; OsI_18555; OsJ_01561; OsJ_17207; Ot11g0

Source	GOs	Term	Type	Identity
Sma3	cytoplasm	GO:0005737	Cellular Component	-
Sma3	mitochondrial matrix	GO:0005759	Cellular Component	-
Sma3	glycine cleavage complex	GO:0005960	Cellular Component	-
Sma3	chloroplast	GO:0009507	Cellular Component	-
Sma3	apoplast	GO:0048046	Cellular Component	-
Sma3	dihydrolipoyl dehydrogenase activity	GO:0004148	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	flavin adenine dinucleotide binding	GO:0050660	Molecular Function	-
Sma3	cell redox homeostasis	GO:0045454	Biological Process	-
Sma3	response to cadmium ion	GO:0046686	Biological Process	-
Sma3	oxidation-reduction process	GO:0055114	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Mercuric reductase	IPR000815	-	-
Sma3	2-oxoacid dehydrogenase acyltransferase, catalytic domain	IPR001078	-	-
Sma3	Pyridine nucleotide-disulphide oxidoreductase, NAD-binding domain	IPR001327	-	-
Sma3	Helicase, C-terminal	IPR001650	-	-
Sma3	Polymerase/histidinol phosphatase, N-terminal	IPR003141	-	-
Sma3	Adaptor protein ClpS, core	IPR003769	-	-
Sma3	PHP, C-terminal	IPR004013	-	-
Sma3	Pyridine nucleotide-disulphide oxidoreductase, dimerisation	IPR004099	-	-
Sma3	Clp, N-terminal	IPR004176	-	-
Sma3	Nucleic acid binding, OB-fold, tRNA/helicase-type	IPR004365	-	-
Sma3	DNA polymerase III, alpha subunit	IPR004805	-	-
Sma3		IPR004949	-	-
Sma3	ATPase, AFG1-like	IPR005654	-	-
Sma3	Dihydrolipoamide dehydrogenase	IPR006258	-	-
Sma3	ATP-dependent helicase, C-terminal	IPR006555	-	-
Sma3	Bacterial DNA polymerase III, alpha subunit	IPR011708	-	-
Sma3	Pyridine nucleotide-disulphide oxidoreductase, class I, active site	IPR012999	-	-
Sma3	FAD-dependent pyridine nucleotide-disulphide oxidoreductase	IPR013027	-	-
Sma3	Helicase, superfamily 1/2, ATP-binding domain	IPR014001	-	-
Sma3	Helicase, superfamily 1/2, ATP-binding domain, DinG/Rad3-type	IPR014013	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT1G48030.1	mtLPD1 mitochondrial lipoamide dehydrogenase 1 chr1:17717432-17719141 REVERSE LENGTH=507	2.0e-25	73%
RefSeq	Arabidopsis thaliana	NP_175237.1	dihydrolipoyl dehydrogenase 1 [Arabidopsis thaliana]	3.0e-25	73%
RefSeq	Populus trichocarpa	XP_002311367.1	precursor of dehydrogenase dihydrolipoamide dehydrogenase 1 [Populus trichocarpa]	1.0e-26	77%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: B8LQQ4

Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 82 aas, your sequence is shorter than subject: 79 - 502

Fln protein: QDKYSWNLCYW*CDSSVPFLFLAHKAEEDGFACAELIAGKPGHVDYDTVPGIVYTHPEVASVGKTEEQVKALNTPYKVG

Protein Length: 80

Fln nts: CAGGACAAATATTCCTGGAATTTATGCTATTGGTGATGTGATTCCTCGGTCCCATTTTTGTTTCTTGCACACAAGGCTGAAGAAGATGGCTTTGCCTGTGCAGAGCTTATTGCAGGAAAACCTGGACATGTGGACTATGACACTGTACCTGGAATTGTTTATACACATCCAGAGGTAGCTTCAGTAGGAAAGACAGAGGAGCAGGTCAAGGCTCTGAATACCCCATACAAAGTTGGA

Fln Alignment:

GFXCM5X02IORZS___VPFLFLAHKAEEDGFACAELIAGKPGHVDYDTVPGIVYTHPEVASVGKTEEQVKALNTPYKVG
B8LQQ4_______________IPGPMLAHKAEEDGVACAELIAGKAGHVDYDTVPGIVYTHPEVASVGKTEEQVKALNIPYKVG

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain