UniGene Name: sp_v3.0_unigene65407
Length: 173 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense) |
---|
>sp_v3.0_unigene65407
T |
Ace file of the UniGene sp_v3.0_unigene65407 (antisense) |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] sp|Q9FJY7.1|PP449_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g66520 dbj|BAB10928.1| selenium-binding protein-like [Arabidopsis thaliana] gb|AED98224.1| pentatricope | - | - | 1.0e-15 | 66% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 68% |
Sma3 | Putative pentatricopeptide (PPR) repeat-containing protein | - | - | 5.109e-08 | - |
Source | Gene names |
---|---|
Sma3 | At1g15510; At3g26782; At4g01030; At5g66520; B1032F05.19; F3I3.50; GSVIVT00000887001; GSVIVT00002188001; GSVIVT00002920001; GSVIVT00006516001; GSVIVT00007922001; GSVIVT00013634001; GSVIVT00016277001; GSVIVT00016451001; GSVIVT00018529001; GSVIVT00020997001; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | ubiquitin thiolesterase activity | GO:0004221 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | deaminase activity | GO:0019239 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | ubiquitin-dependent protein catabolic process | GO:0006511 | Biological Process | 0.0 | - |
Sma3 | purine ribonucleoside monophosphate biosynthetic process | GO:0009168 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Serine-threonine/tyrosine-protein kinase catalytic domain | IPR001245 | - | 0.0 | - |
Sma3 | Adenosine/AMP deaminase domain | IPR001365 | - | 0.0 | - |
Sma3 | Peptidase C12, ubiquitin carboxyl-terminal hydrolase 1 | IPR001578 | - | 0.0 | - |
Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
Sma3 | Immunoglobulin/major histocompatibility complex, conserved site | IPR003006 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | Thioredoxin, conserved site | IPR017937 | - | 0.0 | - |
Sma3 | Asp/Glu racemase, active site | IPR018187 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G66520.1 | Tetratricopeptide repeat (TPR)-like superfamily protein chr5:26551879-26553741 FORWARD LENGTH=620 | 1.0e-20 | 66% |
RefSeq | Arabidopsis thaliana | NP_201453.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 2.0e-20 | 66% |
RefSeq | Populus trichocarpa | XP_002320193.1 | predicted protein [Populus trichocarpa] | 1.0e-20 | 65% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LLJ0
Fln msg: Distance to subject end: 65 aas, your sequence is shorter than subject: 57 - 644
Fln protein:
P
Protein Length:
58
Fln nts:
T
Fln Alignment:
G5KS2UX02GWML2___PSTEHHMCMVDLLGRAGYFDEARDFINKMPLKPDAGVWNCLLAACRIHNNIELGEHI
B8LLJ0_______________PAMEHYGCMIDLLGRAGCFDEANDLINKMPIKPDADMWGSLLSACRTHNNIDLGEKV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain