SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene65357

Length: 113 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>sp_v3.0_unigene65357
GACTCGACGACAGGTGATTGTGTACATGTCGATTTCAGTTGTCTTTTTGACAAAGGTTTGCAGTTACAGAAACCTGAACTTGTCCCTTTTCGACTCACTCAGAATATGACATT

Ace file of the UniGene sp_v3.0_unigene65357 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	serine/threonine-protein kinase ATR [Arabidopsis thaliana] sp\|Q9FKS4.2\|ATR_ARATH RecName: Full=Serine/threonine-protein kinase ATR; Short=AtATR; AltName: Full=Ataxia telangiectasia-mutated and Rad3-related homolog; AltName: Full=DNA repair protein ATR; Al	-	-	3.0e-13	94%
FL-Next	sp=Serine/threonine-protein kinase ATR; Arabidopsis thaliana (Mouse-ear cress).	-	-	0.0	94%
Sma3	Serine/threonine-protein kinase ATR	-	-	1.975e-08	-

Source	ECs	Term	Type	e value	Identity
Sma3	Non-specific serine/threonine protein kinase.	EC:2.7.11.1	-	3.166e-06	-

Source	Gene names
Sma3	ATR; ATR1; At5g40820; CHLREDRAFT_205974; GSVIVT00036181001; LOC_Os06g50910; MHK7.5; MICPUCDRAFT_28270; MICPUN_75688; OSTLU_32774; Os06g0724700; OsI_023634; OsI_24505; OsJ_22700; Ot07g03350; P0535F09.39; P0548E04.6; PHYPADRAFT_129584; POPTRDRAFT_790118; PO

Source	GOs	Term	Type	Identity
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	chromosome	GO:0005694	Cellular Component	-
Sma3	protein serine/threonine kinase activity	GO:0004674	Molecular Function	-
Sma3	binding	GO:0005488	Molecular Function	-
Sma3	kinase activity	GO:0016301	Molecular Function	-
Sma3	phosphotransferase activity, alcohol group as acceptor	GO:0016773	Molecular Function	-
Sma3	DNA repair	GO:0006281	Biological Process	-
Sma3	telomere maintenance via telomerase	GO:0007004	Biological Process	-
Sma3	cell cycle	GO:0007049	Biological Process	-
Sma3	meiosis	GO:0007126	Biological Process	-
Sma3	response to aluminum ion	GO:0010044	Biological Process	-
Sma3	response to gamma radiation	GO:0010332	Biological Process	-
Sma3	regulation of telomere maintenance	GO:0032204	Biological Process	-
Sma3	multicellular organism reproduction	GO:0032504	Biological Process	-
Sma3	telomere maintenance in response to DNA damage	GO:0043247	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Phosphatidylinositol 3-/4-kinase, catalytic domain	IPR000403	-	-
Sma3	PIK-related kinase, FAT	IPR003151	-	-
Sma3	PIK-related kinase, FATC	IPR003152	-	-
Sma3	Armadillo-like helical	IPR011989	-	-
Sma3	Tetratricopeptide-like helical	IPR011990	-	-
Sma3	UME	IPR012993	-	-
Sma3	PIK-related kinase	IPR014009	-	-
Sma3	Phosphatidylinositol 3/4-kinase, conserved site	IPR018936	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT5G40820.1	ATRAD3, ATR, ATATR Ataxia telangiectasia-mutated and RAD3-related chr5:16343860-16353847 REVERSE LENGTH=2702	5.0e-18	94%
RefSeq	Arabidopsis thaliana	NP_198898.2	serine/threonine-protein kinase ATR [Arabidopsis thaliana]	7.0e-18	94%
RefSeq	Populus trichocarpa	XP_002305538.1	predicted protein [Populus trichocarpa]	2.0e-18	97%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: sp_plants

Fln subject: Q9FKS4

Fln msg: Distance to subject end: 110 aas, your sequence is shorter than subject: 37 - 2702

Fln protein: DSTTGDCVHVDFSCLFDKGLQLQKPELVPFRLTQNMT

Protein Length: 38

Fln nts: GACTCGACGACAGGTGATTGTGTACATGTCGATTTCAGTTGTCTTTTTGACAAAGGTTTGCAGTTACAGAAACCTGAACTTGTCCCTTTTCGACTCACTCAGAATATGACATT

Fln Alignment:

G5KS2UX02HGACP___DSTTGDCVHVDFSCLFDKGLQLQKPELVPFRLTQNM
Q9FKS4_______________DSTSGDCVHVDFSCLFDKGLQLEKPELVPFRLTQNM

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain