UniGene Name: sp_v3.0_unigene65336
Length: 163 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene65336
A |
Ace file of the UniGene sp_v3.0_unigene65336
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | ATP-binding cassette transporter, subfamily C, member 8, group MRP protein PpABCC8 n=1 Tax=Physcomitrella patens subsp. patens RepID=A9SZM0_PHYPA | - | - | 6.0e-17 | 86% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 68% |
| Sma3 | Multidrug resistance protein ABC transporter family | - | - | 0.0 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | 2-alkenal reductase. | EC:1.3.1.74 | - | 2.078e-09 | - |
| Sma3 | Xenobiotic-transporting ATPase. | EC:3.6.3.44 | - | 1.382e-40 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g04120; At1g30400; At1g30410; At1g30420; At2g34660; At2g47800; At3g13080; At3g13090; At3g13100; At3g21250; At3g59140; At3g60160; At3g60970; At3g62700; B1065G12.13; B1157F09.14; CHLREDRAFT_141872; CHLREDRAFT_143900; CHLREDRAFT_190380; CHLREDRAFT_54676; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plant-type vacuole | GO:0000325 | Cellular Component | 0.0 | - |
| Sma3 | vacuolar membrane | GO:0005774 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
| Sma3 | calmodulin binding | GO:0005516 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | sulfonylurea receptor activity | GO:0008281 | Molecular Function | 0.0 | - |
| Sma3 | folic acid transporter activity | GO:0008517 | Molecular Function | 0.0 | - |
| Sma3 | xenobiotic-transporting ATPase activity | GO:0008559 | Molecular Function | 0.0 | - |
| Sma3 | chlorophyll catabolite transmembrane transporter activity | GO:0010290 | Molecular Function | 0.0 | - |
| Sma3 | glutathione S-conjugate-exporting ATPase activity | GO:0015431 | Molecular Function | 0.0 | - |
| Sma3 | ATPase activity | GO:0016887 | Molecular Function | 0.0 | - |
| Sma3 | ATPase activity, coupled to transmembrane movement of substances | GO:0042626 | Molecular Function | 0.0 | - |
| Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
| Sma3 | response to water deprivation | GO:0009414 | Biological Process | 0.0 | - |
| Sma3 | response to wounding | GO:0009611 | Biological Process | 0.0 | - |
| Sma3 | response to nematode | GO:0009624 | Biological Process | 0.0 | - |
| Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
| Sma3 | stomatal movement | GO:0010118 | Biological Process | 0.0 | - |
| Sma3 | cellular potassium ion homeostasis | GO:0030007 | Biological Process | 0.0 | - |
| Sma3 | response to other organism | GO:0051707 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Neuraxin/MAP1B repeat | IPR000102 | - | 0.0 | - |
| Sma3 | Aminotransferase, class V/Cysteine desulfurase | IPR000192 | - | 0.0 | - |
| Sma3 | Histidine phosphatase superfamily, clade-2 | IPR000560 | - | 0.0 | - |
| Sma3 | ABC transporter, transmembrane domain | IPR001140 | - | 0.0 | - |
| Sma3 | Proteinase inhibitor I3, Kunitz legume | IPR002160 | - | 0.0 | - |
| Sma3 | ABC transporter-like | IPR003439 | - | 0.0 | - |
| Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
| Sma3 | Phosphopantetheine attachment site | IPR006162 | - | 0.0 | - |
| Sma3 | ABC transporter, conserved site | IPR017871 | - | 0.0 | - |
| Sma3 | ABC transporter, integral membrane type 1 | IPR017940 | - | 0.0 | - |
| Sma3 | Cytochrome P450, conserved site | IPR017972 | - | 0.0 | - |
| Sma3 | Ribosomal protein S2, conserved site | IPR018130 | - | 0.0 | - |
| Sma3 | Hemopexin/matrixin, conserved site | IPR018486 | - | 0.0 | - |
| Sma3 | Peroxidase, active site | IPR019794 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G60970.1 | ATMRP15, MRP15, ABCC15 multidrug resistance-associated protein 15 chr3:22557535-22561575 FORWARD LENGTH=1053 | 2.0e-20 | 80% |
| RefSeq | Arabidopsis thaliana | NP_191656.2 | putative ABC transporter C-15 [Arabidopsis thaliana] | 3.0e-20 | 80% |
| RefSeq | Populus trichocarpa | XP_002321253.1 | multidrug resistance protein ABC transporter family [Populus trichocarpa] | 7.0e-21 | 84% |
Full-Lengther Next Prediction |
|---|
Fln status: Putative N-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NSU0
Fln msg: Distance to subject end: 68 aas, atg_distance in limit (1-15): atg_distance = 10, W2: There is no M at the beginning, your sequence is shorter than subject: 54 - 131
Fln protein:
N
Protein Length:
55
Fln nts:
A
Fln Alignment:
G5KS2UX02H9LII___NVLDSSVAENGGNWSVGQCQLVCLGRALLKQSRILVLDEATASVDSATDGFIQQ
A9NSU0_______________NQLDSSVSDEGENWSAGQRQLLCLGRVLLRRNRILVLDEATASIDSATDALLQK

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta