UniGene Name: sp_v3.0_unigene65335
Length: 128 nt
![]() |
---|
>sp_v3.0_unigene65335
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Os07g0628700 protein n=3 Tax=Oryza sativa RepID=Q0D4F7_ORYSJ | - | - | 1.0e-06 | 83% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 90% |
Sma3 | Putative serine/threonine kinase protein | - | - | 6.643e-13 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Transferases, Transferring phosphorous-containing groups, Protein-serine/threonine kinases. | EC:2.7.11.- | - | 2.922e-12 | - |
Source | Gene names |
---|---|
Sma3 | AT4g00960; A_TM018A10.19; At1g16670; At4g00960; At4g21230; At4g21410; At4g23140; At4g23150; At4g23160; At4g23230; CRK15; CRK27; CRK29; CRK6; CRK7; CRK8; F19K19.4; F21P8.120; F21P8.30; F21P8.40; F21P8.50; F7H19.330; F7J7.170; GSVIVT00002363001; GSVIVT00004 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | recognition of pollen | GO:0048544 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Epidermal growth factor-like domain | IPR000742 | - | 0.0 | - |
Sma3 | S-locus glycoprotein | IPR000858 | - | 0.0 | - |
Sma3 | Serine-threonine/tyrosine-protein kinase catalytic domain | IPR001245 | - | 0.0 | - |
Sma3 | Bulb-type lectin domain | IPR001480 | - | 0.0 | - |
Sma3 | Protein translocase complex, SecE/Sec61-gamma subunit | IPR001901 | - | 0.0 | - |
Sma3 | Patatin/Phospholipase A2-related | IPR002641 | - | 0.0 | - |
Sma3 | Gnk2-homologous domain | IPR002902 | - | 0.0 | - |
Sma3 | Apple-like | IPR003609 | - | 0.0 | - |
Sma3 | Epidermal growth factor-like | IPR006210 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | PAN-2 domain | IPR013227 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | Aconitase family, 4Fe-4S cluster binding site | IPR018136 | - | 0.0 | - |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NQB9
Fln msg: Distance to subject end: 136 aas, your sequence is shorter than subject: 42 - 290
Fln protein:
A
Protein Length:
43
Fln nts:
C
Fln Alignment:
G5KS2UX02JYIRR___GYMAPEYAMRGQLSVKVDVYSFGVLLLEIV
A9NQB9_______________GYMAPEYAMLGQLSVKADVYSFGVVLLEIV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain