UniGene Name: sp_v3.0_unigene65305
Length: 136 nt
![]() |
---|
>sp_v3.0_unigene65305
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Unassigned protein | - | - | 0.0 | - |
FL-Next | sp=Probable serine/threonine-protein kinase At1g54610; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 73% |
Sma3 | Cyclin-dependent protein kinase-like protein | - | - | 1.746e-07 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | [RNA-polymerase]-subunit kinase. | EC:2.7.11.23 | - | 5.615e-15 | - |
Source | Gene names |
---|---|
Sma3 | AT4g10010; AT5G44290; At1g03740; At1g18670; At1g33770; At1g53050; At1g54610; At1g57700; At1g74330; At3g01085; At3g05050; At5g44290; B1329D01.21; CDC2CAt; F14J9.26; F14M2.11; F1M20.1; F26A9.10; F6A14.22; GSVIVT00016287001; GSVIVT00018593001; GSVIVT00019823 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | kinase activity | GO:0016301 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | cell division | GO:0051301 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Isopenicillin N synthase | IPR002283 | - | 0.0 | - |
Sma3 | Serine/threonine- / dual-specificity protein kinase, catalytic domain | IPR002290 | - | 0.0 | - |
Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
Sma3 | Oxoglutarate/iron-dependent oxygenase | IPR005123 | - | 0.0 | - |
Sma3 | Xylan biosynthesis protein IRX15/IRX15L | IPR006514 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G53050.1 | Protein kinase superfamily protein chr1:19772574-19775531 FORWARD LENGTH=694 | 4.0e-20 | 85% |
RefSeq | Arabidopsis thaliana | NP_175713.1 | protein kinase-like protein [Arabidopsis thaliana] | 6.0e-20 | 85% |
RefSeq | Populus trichocarpa | XP_002316895.1 | predicted protein [Populus trichocarpa] | 6.0e-21 | 88% |
![]() |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9ZVM9
Fln msg: Distance to subject end: 443 aas, your sequence is shorter than subject: 45 - 572
Fln protein:
Q
Protein Length:
46
Fln nts:
C
Fln Alignment:
G5KS2UX02HYJSD___GEQVAAGWPSWLTSVAGEAIQGWIPRRADSFEKLEKIGQGTY
Q9ZVM9_______________GEQVAAGWPSWLSDACGEALNGWVPRKADTFEKIDKIGQGTY
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain