UniGene Name: sp_v3.0_unigene65281
Length: 218 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene65281
C |
Ace file of the UniGene sp_v3.0_unigene65281 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Retrotransposon protein, putative, Ty3-gypsy subclass n=2 Tax=Oryza sativa RepID=Q10GH3_ORYSJ | - | - | 1.0e-15 | 62% |
| FL-Next | tr=Putative retroelement; Oryza sativa subsp. japonica (Rice). | - | - | 0.0 | 65% |
| Sma3 | Retrotransposon protein, putative, Ty3-gypsy subclass | - | - | 0.0 | - |
| Source | Gene names |
|---|---|
| Sma3 | B1159F04.11; H0201G08.12; H0207B04.5; H0211F06-OSIGBa0153M17.10; H0306B06.3; H0409D10.7; H0502B11.9; H0502G05.10; H0616A11.2; H0616A11.3; H0616A11.5; H0624F09.1; H0807C06-H0308C08.3; H0818H01.18; H0823A09.5; LOC_Os03g15450; LOC_Os03g23110; LOC_Os03g23220; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
| Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | ATPase activity | GO:0016887 | Molecular Function | 0.0 | - |
| Sma3 | protein dimerization activity | GO:0046983 | Molecular Function | 0.0 | - |
| Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
| Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
| Sma3 | Chromo domain/shadow | IPR000953 | - | 0.0 | - |
| Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
| Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
| Sma3 | Peptidase aspartic, active site | IPR001969 | - | 0.0 | - |
| Sma3 | ABC transporter-like | IPR003439 | - | 0.0 | - |
| Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
| Sma3 | Retrotransposon gag protein | IPR005162 | - | 0.0 | - |
| Sma3 | Domain of unknown function DUF659 | IPR007021 | - | 0.0 | - |
| Sma3 | Domain of unknown function DUF834 | IPR008552 | - | 0.0 | - |
| Sma3 | HAT dimerisation | IPR008906 | - | 0.0 | - |
| Sma3 | Retroviral aspartyl protease | IPR013242 | - | 0.0 | - |
Full-Lengther Next Prediction |
|---|
Fln status: Putative C-terminus
Fln database: tr_plants
Fln subject: Q8LM85
Fln msg: STOP codon was not found. Distance to subject end: 7 aas, your sequence is shorter than subject: 72 - 241
Fln protein:
N
Protein Length:
73
Fln nts:
C
Fln Alignment:
G5KS2UX02HDU4M___NAPAVFMNLINSAFRQYLDKFVQVFLDDILIYSKNXXXXXXHLRLVLSCLRECQLYGKLSKCSFFQEKI
Q8LM85_______________NAPAFFMNLMNKVFMEYLDKFVVVFIDDILVYSQSEEDHQHHLRLVLGKLREHQLYAKLSKCEFWLSEV

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)