UniGene Name: sp_v3.0_unigene65229
Length: 243 nt
UniGene Fasta |
---|
>sp_v3.0_unigene65229
A |
Ace file of the UniGene sp_v3.0_unigene65229 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Retrotransposon gag protein n=1 Tax=Asparagus officinalis RepID=Q2AA50_ASPOF | - | - | 5.0e-21 | 57% |
FL-Next | tr=F7F22.17, putative; Asparagus officinalis (Garden asparagus). | - | - | 0.0 | 57% |
Source | Gene names |
---|---|
Sma3 | 19.t00014; 19.t00017; AT4g07600; AT4g07660; GSVIVT00005459001; GSVIVT00005481001; GSVIVT00005536001; GSVIVT00005553001; GSVIVT00008081001; GSVIVT00009118001; LOC_Os03g41624; LOC_Os12g20040; OSJNBb0007E22.28; OSJNBb0021I10.3; OSJNBb0060M15.10; OSJNBb0067G1 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | carbohydrate metabolic process | GO:0005975 | Biological Process | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | fatty acid biosynthetic process | GO:0006633 | Biological Process | 0.0 | - |
Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
RefSeq | Populus trichocarpa | XP_002336419.1 | predicted protein, partial [Populus trichocarpa] | 3.0e-12 | 51% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: tr_plants
Fln subject: Q2AA42
Fln msg: Distance to subject end: 351 aas, your sequence is shorter than subject: 80 - 680
Fln protein:
C
Protein Length:
81
Fln nts:
A
Fln Alignment:
G5KS2UX02IQ0XF___YNQIRIAP*DQEKTTFTCPWGTNAYKVLPFVLCNTPTIFQRAILGIFSDLLYDCIEVYMDNFTVIGDTFEEALHNI
Q2AA42_______________YNQIPIAPEDQEKTTFTCPYGTFAYRRMPFGLCNAPATFQRYMISIFSDMVERFLEIFMDDFSIFGDTFSQCLHHL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain