UniGene Name: sp_v3.0_unigene65211
Length: 225 nt
UniGene Fasta |
---|
>sp_v3.0_unigene65211
A |
Ace file of the UniGene sp_v3.0_unigene65211 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Putative ERD6-like transporter n=2 Tax=Vitis vinifera RepID=E3VWX8_VITVI | - | - | 3.0e-15 | 54% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 90% |
Sma3 | Chromosome chr14 scaffold_164, whole genome shotgun sequence | - | - | 5.786e-14 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | 2-alkenal reductase. | EC:1.3.1.74 | - | 1.073e-06 | - |
Source | Gene names |
---|---|
Sma3 | At2g48020; At3g05150; At5g18840; F17K4.90; GSVIVT00006081001; GSVIVT00006088001; GSVIVT00006098001; GSVIVT00006099001; GSVIVT00006100001; GSVIVT00019852001; GSVIVT00023634001; LOC_Os03g24870; LOC_Os11g42430; Os03g0363600; OsI_11677; OsJ_10945; OsJ_34588; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | sugar:hydrogen symporter activity | GO:0005351 | Molecular Function | 0.0 | - |
Sma3 | substrate-specific transmembrane transporter activity | GO:0022891 | Molecular Function | 0.0 | - |
Sma3 | carbohydrate transport | GO:0008643 | Biological Process | 0.0 | - |
Sma3 | transmembrane transport | GO:0055085 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Sugar/inositol transporter | IPR003663 | - | 0.0 | - |
Sma3 | General substrate transporter | IPR005828 | - | 0.0 | - |
Sma3 | Sugar transporter, conserved site | IPR005829 | - | 0.0 | - |
Sma3 | Twin-arginine translocation pathway, signal sequence | IPR006311 | - | 0.0 | - |
Sma3 | Major facilitator superfamily | IPR011701 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G18840.1 | Major facilitator superfamily protein chr5:6282954-6286399 FORWARD LENGTH=482 | 5.0e-18 | 61% |
RefSeq | Arabidopsis thaliana | NP_568367.1 | sugar transporter ERD6-like 16 [Arabidopsis thaliana] | 6.0e-18 | 61% |
RefSeq | Populus trichocarpa | XP_002315546.1 | predicted protein [Populus trichocarpa] | 5.0e-18 | 61% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NXP9
Fln msg: Distance to subject end: 245 aas, your sequence is shorter than subject: 74 - 388
Fln protein:
C
Protein Length:
75
Fln nts:
A
Fln Alignment:
G5KS2UX02IGVFO___KSLRGVLTTTNQLFITTGTLIVYLIGVLVTWRTLAITGVXXXXXXXXXXXXXXESPRWLAKVGREKDFEVALQ
A9NXP9_______________KSLRGVLTTTNQLFITTGTLIVYLLGMLVNWRILAITGVIFPILLLTGLFLIPESPRWLAKVGRGKDFEAALQ
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain