UniGene Name: sp_v3.0_unigene65199
Length: 248 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene65199
A |
Ace file of the UniGene sp_v3.0_unigene65199
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | IAA-amino acid hydrolase ILR1, putative n=1 Tax=Ricinus communis RepID=B9S5P0_RICCO | - | - | 2.0e-19 | 70% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 87% |
| Sma3 | IAA-amino acid hydrolase ILR1, putative | - | - | 6.86e-19 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Hydrolases, Acting on carbon-nitrogen bonds, other than peptide bonds, In linear amides. | EC:3.5.1.- | - | 1.063e-24 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Lysine biosynthesis | 00300 | 1.063e-24 | % | |
| Sma3 | Fluorobenzoate degradation | 00364 | 1.063e-24 | % | |
| Sma3 | Glutathione metabolism | 00480 | 1.063e-24 | % | |
| Sma3 | Amino sugar and nucleotide sugar metabolism | 00520 | 1.063e-24 | % | |
| Sma3 | Lipopolysaccharide biosynthesis | 00540 | 1.063e-24 | % | |
| Sma3 | Sphingolipid metabolism | 00600 | 1.063e-24 | % | |
| Sma3 | Metabolic pathways | 01100 | 1.063e-24 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 1.063e-24 | % | |
| Sma3 | Hippurate hydrolase. | EC:3.5.1.32 | - | 4.115e-18 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phenylalanine metabolism | 00360 | 4.115e-18 | % | |
| Sma3 | Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid | 01064 | 4.115e-18 | % |
| Source | Gene names |
|---|---|
| Sma3 | At1g44350; At5g54140; At5g56650; At5g56660; GR1; GSVIVT00015404001; GSVIVT00021549001; GSVIVT00021551001; GSVIVT00028906001; GSVIVT00028908001; GSVIVT00034215001; GSVIVT00037152001; GSVIVT00037153001; IAR; IAR3; IAR33; IAR36; ILL1; ILL10; ILL11; ILL2; ILL |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
| Sma3 | endoplasmic reticulum lumen | GO:0005788 | Cellular Component | 0.0 | - |
| Sma3 | metallopeptidase activity | GO:0008237 | Molecular Function | 0.0 | - |
| Sma3 | IAA-Ala conjugate hydrolase activity | GO:0010179 | Molecular Function | 0.0 | - |
| Sma3 | manganese ion binding | GO:0030145 | Molecular Function | 0.0 | - |
| Sma3 | protein dimerization activity | GO:0046983 | Molecular Function | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Sma3 | auxin metabolic process | GO:0009850 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peptidase M20 | IPR002933 | - | 0.0 | - |
| Sma3 | IPR010168 | - | 0.0 | - | |
| Sma3 | Peptidase M20, dimerisation | IPR011650 | - | 0.0 | - |
| Sma3 | Amidohydrolase | IPR017439 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G44350.1 | ILL6 IAA-leucine resistant (ILR)-like gene 6 chr1:16834749-16838201 REVERSE LENGTH=464 | 5.0e-21 | 65% |
| RefSeq | Arabidopsis thaliana | NP_175086.1 | IAA-amino acid hydrolase ILR1-like 6 [Arabidopsis thaliana] | 7.0e-21 | 65% |
| RefSeq | Populus trichocarpa | XP_002321954.1 | iaa-amino acid hydrolase 5, partial [Populus trichocarpa] | 2.0e-25 | 67% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LMJ2
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 199 aas, your sequence is shorter than subject: 74 - 456
Fln protein:
C
Protein Length:
75
Fln nts:
A
Fln Alignment:
G5KS2UX02IUF0K___HKDKLQGTVRLIFQPAEEGGGGAAHMIREGALGDAEAIFAMHVMPSHSTGTIASTPGPILAGSGIFEAVIE
B8LMJ2_______________HKDKLQGTVRLIFQPAEEGGAGAAHMIREGALGDAEAIFAMHVTPGLSTGAIVSIPGPILAGASIFEAVIE

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta