|
||||||
|
UniGene Name: sp_v3.0_unigene65184
Length: 211 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene65184
C |
|
Ace file of the UniGene sp_v3.0_unigene65184 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Cytochrome P450 704C1 n=1 Tax=Pinus taeda RepID=C04C1_PINTA | - | - | 2.0e-23 | 64% |
| FL-Next | sp=Cytochrome P450 704C1; Pinus taeda (Loblolly pine). | - | - | 0.0 | 64% |
| Sma3 | Cytochrome P450-like protein | - | - | 5.335e-11 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Unspecific monooxygenase. | EC:1.14.14.1 | - | 6.702e-07 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Fatty acid metabolism | 00071 | 6.702e-07 | % | |
| Sma3 | Steroid hormone biosynthesis | 00140 | 6.702e-07 | % | |
| Sma3 | Caffeine metabolism | 00232 | 6.702e-07 | % | |
| Sma3 | Tryptophan metabolism | 00380 | 6.702e-07 | % | |
| Sma3 | Arachidonic acid metabolism | 00590 | 6.702e-07 | % | |
| Sma3 | Linoleic acid metabolism | 00591 | 6.702e-07 | % | |
| Sma3 | Aminobenzoate degradation | 00627 | 6.702e-07 | % | |
| Sma3 | Retinol metabolism | 00830 | 6.702e-07 | % | |
| Sma3 | Metabolism of xenobiotics by cytochrome P450 | 00980 | 6.702e-07 | % | |
| Sma3 | Drug metabolism - cytochrome P450 | 00982 | 6.702e-07 | % | |
| Sma3 | Drug metabolism - other enzymes | 00983 | 6.702e-07 | % | |
| Sma3 | Biosynthesis of alkaloids derived from shikimate pathway | 01063 | 6.702e-07 | % | |
| Sma3 | Metabolic pathways | 01100 | 6.702e-07 | % |
| Source | Gene names |
|---|---|
| Sma3 | At1g69500; At1g69500/F10D13_15; At2g44890; At2g45510; At5g08250; At5g23190; CYP704A10; CYP704A11; CYP704A14; CYP704B3; CYP704C1; CYP704G7; CYP704G9; CYP86B4; CYP86B5; CYP94C9; F10D13_15; GSVIVT00026263001; GSVIVT00026264001; GSVIVT00026267001; GSVIVT00026 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | monooxygenase activity | GO:0004497 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | ATPase, F1 complex, OSCP/delta subunit | IPR000711 | - | 0.0 | - |
| Sma3 | Cytochrome P450 | IPR001128 | - | 0.0 | - |
| Sma3 | Legume lectin domain | IPR001220 | - | 0.0 | - |
| Sma3 | Lipocalin | IPR002345 | - | 0.0 | - |
| Sma3 | Cytochrome P450, E-class, group I | IPR002401 | - | 0.0 | - |
| Sma3 | Cytochrome P450, E-class, group IV | IPR002403 | - | 0.0 | - |
| Sma3 | Cytochrome P450, conserved site | IPR017972 | - | 0.0 | - |
| Sma3 | IPR017973 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G69500.1 | CYP704B1 cytochrome P450, family 704, subfamily B, polypeptide 1 chr1:26123960-26125909 FORWARD LENGTH=524 | 6.0e-27 | 66% |
| RefSeq | Arabidopsis thaliana | NP_177109.3 | cytochrome P450, family 704, subfamily B, polypeptide 1 [Arabidopsis thaliana] | 8.0e-27 | 66% |
| RefSeq | Populus trichocarpa | XP_002320074.1 | cytochrome P450 [Populus trichocarpa] | 3.0e-29 | 66% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q50EK3
Fln msg: Distance to subject end: 60 aas, your sequence is shorter than subject: 69 - 518
Fln protein:
D
Protein Length:
70
Fln nts:
C
Fln Alignment:
G5KS2UX02FI8NU___DAKYVVSDDILPDGFKIKKGDLISYVPYSMGRMTYIWGSDAEEFRPERWLESGVFKSQSPFKFTAFQA
Q50EK3_______________DGKYVVNEDTLPDGFKVKKGDSVNFLPYAMGRMSYLWGDDAKEFKPERWIQDGIFHPKSPFKFPAFQA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
