UniGene Name: sp_v3.0_unigene65173
Length: 237 nt
![]() |
---|
>sp_v3.0_unigene65173
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | RecName: Full=Mitogen-activated protein kinase 15; Short=MAP kinase 15 gb|AAX94956.1| Protein kinase domain, putative [Oryza sativa Japonica Group] gb|ABA92667.1| Extracellular signal-regulated kinase 1, putative, expressed [Oryza sativa Japonica Group] d | - | - | 8.0e-22 | 68% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 72% |
Sma3 | Big map kinase/bmk, putative | - | - | 2.237e-14 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Mitogen-activated protein kinase. | EC:2.7.11.24 | - | 0.0 | - |
Source | Gene names |
---|---|
Sma3 | AT2G01450; At1g18150; At1g53510; At1g73670; At2g01450; At2g42880; At3g14720; At3g18040; At5g19010; BIMK2; BWMK1; BWMK2; CHLREDRAFT_108650; CHLREDRAFT_137528; F22G10.12; F25P22.9; F2I9.7; F7D19.12; GSVIVT00017805001; GSVIVT00018914001; GSVIVT00019886001; G |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
Sma3 | MAP kinase activity | GO:0004707 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | defense response | GO:0006952 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Serine/threonine- / dual-specificity protein kinase, catalytic domain | IPR002290 | - | 0.0 | - |
Sma3 | MAP kinase, conserved site | IPR003527 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G19010.1 | MPK16 mitogen-activated protein kinase 16 chr5:6345096-6347676 REVERSE LENGTH=567 | 3.0e-27 | 80% |
RefSeq | Arabidopsis thaliana | NP_197402.1 | mitogen-activated protein kinase 16 [Arabidopsis thaliana] | 4.0e-27 | 80% |
RefSeq | Populus trichocarpa | XP_002314421.1 | predicted protein [Populus trichocarpa] | 8.0e-29 | 87% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LQQ5
Fln msg: Distance to subject end: 232 aas, your sequence is shorter than subject: 78 - 612
Fln protein:
C
Protein Length:
79
Fln nts:
A
Fln Alignment:
G5KS2UX02IHL3Y___VHQLDLITDLLGTPSLEAITRVRNEKTRRYLSSMRKKKPMQFSRKFPNADPXXXXXXXXXXXFEPNDRPTAEE
B8LQQ5_______________VHQLDIMTDLLGTPSAETLARIRNEKARRYLSNMRKKQPTPFSQKFPNVDPFAIRLLERMLAFDPKDRPSAEE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain