|
||||||
|
UniGene Name: sp_v3.0_unigene65153
Length: 144 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene65153
A |
|
Ace file of the UniGene sp_v3.0_unigene65153
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Pol protein n=1 Tax=Cucumis melo subsp. melo RepID=Q84KB0_CUCME | - | - | 2.0e-10 | 64% |
| FL-Next | tr=Uncharacterized protein; Phytophthora ramorum (Sudden oak death agent). | - | - | 0.0 | 66% |
| Sma3 | Retrotransposon protein, putative, Ty3-gypsy subclass | - | - | 0.0 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT4g07850; F5K24.1; H0207B04.5; H0306B06.3; H0306F03.2; H0409D10.7; H0502B11.9; H0502G05.12; H0512B01.1; H0613A10.2; H0616A11.3; H0807C06-H0308C08.3; H0807C06-H0308C08.9; LOC_Os03g04860; LOC_Os03g15450; LOC_Os03g23110; LOC_Os03g23200; LOC_Os03g23780; LOC_ |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
| Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
| Sma3 | cysteine-type peptidase activity | GO:0008234 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
| Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
| Sma3 | Chromo domain/shadow | IPR000953 | - | 0.0 | - |
| Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
| Sma3 | Actinin-type, actin-binding, conserved site | IPR001589 | - | 0.0 | - |
| Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
| Sma3 | Peptidase aspartic, active site | IPR001969 | - | 0.0 | - |
| Sma3 | Peptidase A2A, retrovirus, catalytic | IPR001995 | - | 0.0 | - |
| Sma3 | Peptidase C48, SUMO/Sentrin/Ubl1 | IPR003653 | - | 0.0 | - |
| Sma3 | Retrotransposon gag protein | IPR005162 | - | 0.0 | - |
| Sma3 | Domain of unknown function DUF834 | IPR008552 | - | 0.0 | - |
| Sma3 | Retroviral aspartyl protease | IPR013242 | - | 0.0 | - |
| Sma3 | Zinc finger, H2C2-type, histone UAS binding | IPR015416 | - | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: tr_plants
Fln subject: H3GAZ9
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 38 aas, your sequence is shorter than subject: 39 - 144
Fln protein:
M
Protein Length:
40
Fln nts:
A
Fln Alignment:
G5KS2UX02I2L5L___ISNRDAKFTSRFWKELFTGLGTKLAFSTTYHPQTDG*TERVNRIL
H3GAZ9_______________VSDRDPRFTARFWQEVFTLLGTQLSMSTADHPQTDGQTERVNRVL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
