UniGene Name: sp_v3.0_unigene65150
Length: 168 nt
UniGene Fasta |
---|
>sp_v3.0_unigene65150
A |
Ace file of the UniGene sp_v3.0_unigene65150 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | OSJNBa0074B10.9 protein n=2 Tax=Oryza sativa Japonica Group RepID=Q7XS91_ORYSJ | - | - | 5.0e-13 | 70% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 37% |
Sma3 | Retrotransposon protein, putative, Ty3-gypsy subclass | - | - | 2.36819e-42 | - |
Source | Gene names |
---|---|
Sma3 | B1234D02.1; H0124E07.7; H0425E08.11; H0512B01.1; H0515C11.9; H0522A01.6; H0624F09.1; H0818H01.18; H0820C10.2; LOC_Os03g23800; LOC_Os03g29790; LOC_Os03g31930; LOC_Os03g32380; LOC_Os03g32960; LOC_Os03g33140; LOC_Os03g34190; LOC_Os03g35830; LOC_Os03g41960; L |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
Sma3 | ribonuclease H activity | GO:0004523 | Molecular Function | 0.0 | - |
Sma3 | cysteine-type peptidase activity | GO:0008234 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
Sma3 | Chromo domain/shadow | IPR000953 | - | 0.0 | - |
Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
Sma3 | Peptidase aspartic, active site | IPR001969 | - | 0.0 | - |
Sma3 | Ribonuclease H domain | IPR002156 | - | 0.0 | - |
Sma3 | Carbohydrate/puine kinase, PfkB, conserved site | IPR002173 | - | 0.0 | - |
Sma3 | Peptidase C48, SUMO/Sentrin/Ubl1 | IPR003653 | - | 0.0 | - |
Sma3 | Retrotransposon gag protein | IPR005162 | - | 0.0 | - |
Sma3 | Phosphopantetheine attachment site | IPR006162 | - | 0.0 | - |
Sma3 | Retroviral aspartyl protease | IPR013242 | - | 0.0 | - |
Full-Lengther Next Prediction |
---|
Fln status: Putative C-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NWN2
Fln msg: STOP codon was not found. Distance to subject end: 13 aas,
Fln protein:
M
Protein Length:
56
Fln nts:
A
Fln Alignment:
G5KS2UX02FTFVA___MLNKVTIKNWYPLS*IDNLFDQLKGAIIFLKIDMRSRYHYVHI
A9NWN2_______________VLNEITIKDKFHISIVDELLDELYGTMYFLELDQKSNYYHIRV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain