UniGene Name: sp_v3.0_unigene65149
Length: 190 nt
UniGene Fasta |
---|
>sp_v3.0_unigene65149
A |
Ace file of the UniGene sp_v3.0_unigene65149 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Putative polyprotein n=2 Tax=Oryza sativa Japonica Group RepID=Q851Y3_ORYSJ | - | - | 9.0e-16 | 71% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 63% |
Sma3 | Retrotransposon protein, putative, Ty1-copia subclass | - | - | 7.825e-11 | - |
Source | Gene names |
---|---|
Sma3 | B0809H07.1; LOC_Os03g13700; LOC_Os03g22970; LOC_Os03g24260; LOC_Os03g25890; LOC_Os03g59190; LOC_Os10g01750; LOC_Os10g08740; LOC_Os10g10380; LOC_Os10g19064; LOC_Os10g21950; LOC_Os10g34290; LOC_Os11g29950; LOC_Os11g35630; LOC_Os11g36590; LOC_Os11g37710; LOC |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | oxygen evolving complex | GO:0009654 | Cellular Component | 0.0 | - |
Sma3 | extrinsic to membrane | GO:0019898 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | alpha-mannosidase activity | GO:0004559 | Molecular Function | 0.0 | - |
Sma3 | peroxidase activity | GO:0004601 | Molecular Function | 0.0 | - |
Sma3 | polygalacturonase activity | GO:0004650 | Molecular Function | 0.0 | - |
Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | ATP-dependent helicase activity | GO:0008026 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | kinase activity | GO:0016301 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | phosphotransferase activity, alcohol group as acceptor | GO:0016773 | Molecular Function | 0.0 | - |
Sma3 | nucleoside-triphosphatase activity | GO:0017111 | Molecular Function | 0.0 | - |
Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
Sma3 | carbohydrate binding | GO:0030246 | Molecular Function | 0.0 | - |
Sma3 | carbohydrate metabolic process | GO:0005975 | Biological Process | 0.0 | - |
Sma3 | mannose metabolic process | GO:0006013 | Biological Process | 0.0 | - |
Sma3 | apoptotic process | GO:0006915 | Biological Process | 0.0 | - |
Sma3 | defense response | GO:0006952 | Biological Process | 0.0 | - |
Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
Sma3 | cellular cell wall organization | GO:0007047 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Sma3 | photosynthesis | GO:0015979 | Biological Process | 0.0 | - |
Sma3 | phosphorylation | GO:0016310 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G23160.1 | CRK8 cysteine-rich RLK (RECEPTOR-like protein kinase) 8 chr4:12129485-12134086 FORWARD LENGTH=1262 | 3.0e-15 | 53% |
RefSeq | Arabidopsis thaliana | NP_194047.2 | cysteine-rich receptor-like protein kinase 8 [Arabidopsis thaliana] | 4.0e-15 | 53% |
Full-Lengther Next Prediction |
---|
Fln status: Putative N-terminus
Fln database: coniferopsida.fasta
Fln subject: B8LKV8
Fln msg: Distance to subject end: 297 aas, atg_distance in limit (1-15): atg_distance = 4, Unexpected STOP codon in 5 prime region, your sequence is shorter than subject: 54 - 363
Fln protein:
Y
Protein Length:
55
Fln nts:
A
Fln Alignment:
G5KS2UX02G06HF___WDLVPLPKGHKLVRCKWVYRTKYGPDGKVDKHKARLVAKGFSQVEGIDYTET
B8LKV8_______________WDLVDLPKEKECISVKWVYKTKYKANGELDKHKARLVAKGFAQEYGVDYNET
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain