UniGene Name: sp_v3.0_unigene65148
Length: 194 nt
![]() |
---|
>sp_v3.0_unigene65148
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Calcium-dependent protein kinase (Fragment) n=1 Tax=Arabidopsis thaliana RepID=Q96295_ARATH | - | - | 2.0e-17 | 86% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 94% |
Sma3 | Calcium-dependent protein kinase | - | - | 2.528e-24 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Non-specific serine/threonine protein kinase. | EC:2.7.11.1 | - | 4.495e-13 | - |
Sma3 | Calcium/calmodulin-dependent protein kinase. | EC:2.7.11.17 | - | 5.504e-08 | - |
Source | Gene names |
---|---|
Sma3 | ATEM1.10; At1g18890; At1g74740; At2g41860; At3g51850; At3g57530; At5g12480; At5g19450; CDPK; CDPK1; CDPK19; CDPK1A; CDPK2; CDPK4; CPK1; CPK10; CPK12; CPK13; CPK14; CPK15; CPK19; CPK23; CPK28; CPK3; CPK30; CPK32; CPK7; CPK8; F25A4.29; F6A14.1; F7K24.200; G |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | calcium-dependent protein kinase C activity | GO:0004698 | Molecular Function | 0.0 | - |
Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
Sma3 | abscisic acid mediated signaling pathway | GO:0009738 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ribosomal protein S16 | IPR000307 | - | 0.0 | - |
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Calcium-binding EF-hand | IPR002048 | - | 0.0 | - |
Sma3 | Serine/threonine- / dual-specificity protein kinase, catalytic domain | IPR002290 | - | 0.0 | - |
Sma3 | Parvalbumin | IPR008080 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | EF-hand-like domain | IPR011992 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
Sma3 | EF-hand | IPR018248 | - | 0.0 | - |
Sma3 | EF-HAND 2 | IPR018249 | - | 0.0 | - |
Sma3 | ATPase, P-type phosphorylation site | IPR018303 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G51850.1 | CPK13 calcium-dependent protein kinase 13 chr3:19232667-19235526 FORWARD LENGTH=528 | 3.0e-23 | 86% |
RefSeq | Arabidopsis thaliana | NP_190753.2 | calcium-dependent protein kinase 13 [Arabidopsis thaliana] | 4.0e-23 | 86% |
RefSeq | Populus trichocarpa | XP_002323583.1 | calcium dependent protein kinase 13 [Populus trichocarpa] | 9.0e-22 | 80% |
![]() |
---|
Fln status: C-terminus
Fln database: coniferopsida.fasta
Fln subject: C0PQ38
Fln msg: your sequence is shorter than subject: 60 - 529
Fln protein:
M
Protein Length:
61
Fln nts:
A
Fln Alignment:
G5KS2UX02HR922___FNEVDADKDFGCISYEEFASMMKTGTDWRKASRHYSRGRFNSLSIKLVRDGS
C0PQ38_______________FNEVDADKD-GRISYEEFASMMKTGTDWRKASRHYSRGRFNNLSIKLVRDGS
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain