UniGene Name: sp_v3.0_unigene65081
Length: 182 nt
UniGene Fasta |
---|
>sp_v3.0_unigene65081
A |
Ace file of the UniGene sp_v3.0_unigene65081 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Auxin response factor 1 n=1 Tax=Cucumis sativus RepID=Q6L8U3_CUCSA | - | - | 6.0e-20 | 81% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 55% |
Sma3 | Auxin response factor, putative | - | - | 1.902e-14 | - |
Source | Gene names |
---|---|
Sma3 | ARF11; ARF12; ARF16; ARF17; ARF19; ARF2; ARF21; ARF25; ARF5; ARF6; ARF6A; ARF6B; ARF7; ARF7A; ARF7B; ARF8; At1g19220; At1g19850; At1g30330; At5g20730; At5g37020; BIP; CsARF1; CsARF2; CsARF3; CsARF4; F6F9.10; FWF; GSVIVT00014459001; GSVIVT00016396001; GSVI |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
Sma3 | transcription activator activity | GO:0016563 | Molecular Function | 0.0 | - |
Sma3 | protein dimerization activity | GO:0046983 | Molecular Function | 0.0 | - |
Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
Sma3 | gravitropism | GO:0009630 | Biological Process | 0.0 | - |
Sma3 | phototropism | GO:0009638 | Biological Process | 0.0 | - |
Sma3 | response to ethylene stimulus | GO:0009723 | Biological Process | 0.0 | - |
Sma3 | response to hormone stimulus | GO:0009725 | Biological Process | 0.0 | - |
Sma3 | auxin mediated signaling pathway | GO:0009734 | Biological Process | 0.0 | - |
Sma3 | blue light signaling pathway | GO:0009785 | Biological Process | 0.0 | - |
Sma3 | flower development | GO:0009908 | Biological Process | 0.0 | - |
Sma3 | longitudinal axis specification | GO:0009942 | Biological Process | 0.0 | - |
Sma3 | leaf vascular tissue pattern formation | GO:0010305 | Biological Process | 0.0 | - |
Sma3 | lateral root primordium development | GO:0010386 | Biological Process | 0.0 | - |
Sma3 | root development | GO:0048364 | Biological Process | 0.0 | - |
Sma3 | leaf development | GO:0048366 | Biological Process | 0.0 | - |
Sma3 | meristem development | GO:0048507 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Aminotransferase, class-II, pyridoxal-phosphate binding site | IPR001917 | - | 0.0 | - |
Sma3 | AUX/IAA protein | IPR003311 | - | 0.0 | - |
Sma3 | B3 DNA binding domain | IPR003340 | - | 0.0 | - |
Sma3 | Auxin response factor | IPR010525 | - | 0.0 | - |
Sma3 | Aux/IAA-ARF-dimerisation | IPR011525 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G30330.2 | ARF6 auxin response factor 6 chr1:10686125-10690036 REVERSE LENGTH=935 | 4.0e-24 | 80% |
RefSeq | Arabidopsis thaliana | NP_174323.1 | auxin response factor 6 [Arabidopsis thaliana] | 5.0e-24 | 80% |
RefSeq | Populus trichocarpa | XP_002300854.1 | predicted protein, partial [Populus trichocarpa] | 3.0e-25 | 80% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LRW7
Fln msg: Distance to subject end: 561 aas, your sequence is shorter than subject: 60 - 920
Fln protein:
N
Protein Length:
61
Fln nts:
A
Fln Alignment:
G5KS2UX02JTLR6___VAHAAANQSPFTVFYNPRTSPSEFVVPLAKYNKAVYGTQVSVGMHFRMMFETEESSVR
B8LRW7_______________VAHAVATKSMFHIFYNPRTSPTEFVIPYHKYVKS-FNHSFSIGMRFKMRFETEDATER
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain