UniGene Name: sp_v3.0_unigene65074
Length: 227 nt
UniGene Fasta |
---|
>sp_v3.0_unigene65074
A |
Ace file of the UniGene sp_v3.0_unigene65074 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Unassigned protein | - | - | 0.0 | - |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 41% |
Source | Gene names |
---|---|
Sma3 | VITISV_000081; VITISV_000540; VITISV_001362; VITISV_001411; VITISV_001508; VITISV_001707; VITISV_001876; VITISV_002752; VITISV_003773; VITISV_004379; VITISV_004415; VITISV_005442; VITISV_005692; VITISV_005765; VITISV_005778; VITISV_006366; VITISV_006839; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
Sma3 | endonuclease activity | GO:0004519 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | sequence-specific DNA binding | GO:0043565 | Molecular Function | 0.0 | - |
Sma3 | apoptotic process | GO:0006915 | Biological Process | 0.0 | - |
Sma3 | defense response | GO:0006952 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Sma3 | transposition | GO:0032196 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
Sma3 | F-box domain, cyclin-like | IPR001810 | - | 0.0 | - |
Sma3 | Pleckstrin homology domain | IPR001849 | - | 0.0 | - |
Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
Sma3 | DNA methylase, N-6 adenine-specific, conserved site | IPR002052 | - | 0.0 | - |
Sma3 | Ankyrin repeat | IPR002110 | - | 0.0 | - |
Sma3 | NB-ARC | IPR002182 | - | 0.0 | - |
Sma3 | Helix-hairpin-helix DNA-binding motif, class 1 | IPR003583 | - | 0.0 | - |
Sma3 | Protein of unknown function DUF295 | IPR005174 | - | 0.0 | - |
Sma3 | IPR013084 | - | 0.0 | - | |
Sma3 | Reverse transcriptase, RNA-dependent DNA polymerase | IPR013103 | - | 0.0 | - |
Sma3 | Peptidase A2A, retrovirus RVP subgroup | IPR018061 | - | 0.0 | - |
Full-Lengther Next Prediction |
---|
Fln status: Putative C-terminus
Fln database: coniferopsida.fasta
Fln subject: B8LKV8
Fln msg: STOP codon was not found. Distance to subject end: 10 aas, your sequence is shorter than subject: 75 - 363
Fln protein:
N
Protein Length:
76
Fln nts:
A
Fln Alignment:
G5KS2UX02I3HUU___FLTNPGKQHWQAVKWILRYLKGTSHYCLCFGQDKTI-LKGFTDANMAGDMDTRKSTTGYLIH
B8LKV8_______________FMDTPKNSHWQAGKRLLRYIAGTMNHGILYSTSNNLQLVGYTDSDFAGSIDDRKSTSGYAFH
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain