UniGene Name: sp_v3.0_unigene65060
Length: 200 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense) |
---|
>sp_v3.0_unigene65060
G |
Ace file of the UniGene sp_v3.0_unigene65060 (antisense) |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | putative protein disulfide isomerase [Gossypium hirsutum] | - | - | 2.0e-16 | 82% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 89% |
Sma3 | Protein disulfide isomerase | - | - | 2.134e-19 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein disulfide-isomerase. | EC:5.3.4.1 | - | 5.749e-37 | - |
Source | Gene names |
---|---|
Sma3 | AT2G47470; At1g21750; At1g77510; At2g47470; B1088D01.21; F8K7.19; GSVIVT00015407001; GSVIVT00019277001; GSVIVT00022630001; MICPUN_108102; OSJNBa0006B20.4; Os01g0339900; Os02g0554900; Os05g0156300; OsI_01755; OsI_07640; OsI_15980; OsI_18529; OsI_35452; OsJ |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | lytic vacuole within protein storage vacuole | GO:0000327 | Cellular Component | 0.0 | - |
Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
Sma3 | endoplasmic reticulum lumen | GO:0005788 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | thylakoid | GO:0009579 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | protein disulfide isomerase activity | GO:0003756 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | isomerase activity | GO:0016853 | Molecular Function | 0.0 | - |
Sma3 | double fertilization forming a zygote and endosperm | GO:0009567 | Biological Process | 0.0 | - |
Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
Sma3 | embryo development | GO:0009790 | Biological Process | 0.0 | - |
Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
Sma3 | response to endoplasmic reticulum stress | GO:0034976 | Biological Process | 0.0 | - |
Sma3 | regulation of programmed cell death | GO:0043067 | Biological Process | 0.0 | - |
Sma3 | cell redox homeostasis | GO:0045454 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Sma3 | seed development | GO:0048316 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Disulphide isomerase | IPR005788 | - | 0.0 | - |
Sma3 | Protein disulphide isomerase | IPR005792 | - | 0.0 | - |
Sma3 | IPR006662 | - | 0.0 | - | |
Sma3 | Endoplasmic reticulum, protein ERp29, C-terminal | IPR011679 | - | 0.0 | - |
Sma3 | IPR012335 | - | 0.0 | - | |
Sma3 | Thioredoxin domain | IPR013766 | - | 0.0 | - |
Sma3 | IPR017936 | - | 0.0 | - | |
Sma3 | Thioredoxin, conserved site | IPR017937 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G21750.1 | ATPDIL1-1, ATPDI5, PDI5, PDIL1-1 PDI-like 1-1 chr1:7645767-7648514 FORWARD LENGTH=501 | 3.0e-21 | 80% |
RefSeq | Arabidopsis thaliana | NP_849696.1 | protein disulfide-isomerase A1 [Arabidopsis thaliana] | 4.0e-21 | 80% |
RefSeq | Populus trichocarpa | XP_002307440.1 | predicted protein [Populus trichocarpa] | 4.0e-21 | 76% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LMY5
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 52 aas, your sequence is shorter than subject: 66 - 500
Fln protein:
M
Protein Length:
67
Fln nts:
G
Fln Alignment:
G5KS2UX02IH0O1___KNVLVEFYAPWCGHCKKLAPILEEVAISYENESDVVIAKLDATSND
B8LMY5_______________KNVLLEFYAPWCGHCKKLAPTLEEVAISYENETDVVIAKMDATVND
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain