|
||||||
|
UniGene Name: sp_v3.0_unigene65058
Length: 174 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene65058
A |
|
Ace file of the UniGene sp_v3.0_unigene65058
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Unassigned protein | - | - | 0.0 | - |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 54% |
| Source | Gene names |
|---|---|
| Sma3 | At1g71490; At2g13600; At3g22690; At4g02750; At4g16835; DYW10; F26A9.13; FCAALL.441; GSVIVT00004379001; GSVIVT00006973001; GSVIVT00007631001; GSVIVT00007922001; GSVIVT00008013001; GSVIVT00011403001; GSVIVT00013464001; GSVIVT00013634001; GSVIVT00016456001; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | RNA modification | GO:0009451 | Biological Process | 0.0 | - |
| Sma3 | thylakoid membrane organization | GO:0010027 | Biological Process | 0.0 | - |
| Sma3 | photosystem II assembly | GO:0010207 | Biological Process | 0.0 | - |
| Sma3 | regulation of chlorophyll biosynthetic process | GO:0010380 | Biological Process | 0.0 | - |
| Sma3 | photosystem I assembly | GO:0048564 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peptidase, cysteine peptidase active site | IPR000169 | - | 0.0 | - |
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Beta-lactamase, class-A/D | IPR000871 | - | 0.0 | - |
| Sma3 | Mannose-binding lectin | IPR001229 | - | 0.0 | - |
| Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
| Sma3 | Zinc finger, TTF-type | IPR006580 | - | 0.0 | - |
| Sma3 | Uncharacterised protein family UPF0497, trans-membrane plant | IPR006702 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - | |
| Sma3 | Asp/Glu racemase, active site | IPR018187 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G02750.1 | Tetratricopeptide repeat (TPR)-like superfamily protein chr4:1221116-1223461 REVERSE LENGTH=781 | 1.0e-18 | 63% |
| RefSeq | Arabidopsis thaliana | NP_192184.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 2.0e-18 | 63% |
| RefSeq | Populus trichocarpa | XP_002314911.1 | predicted protein [Populus trichocarpa] | 9.0e-20 | 61% |
| Full-Lengther Next Prediction |
|---|
Fln status: N-terminus
Fln database: coniferopsida.fasta
Fln subject: D5AAE0
Fln msg: Distance to subject end: 177 aas, atg_distance in limit (1-15): atg_distance = 12, your sequence is shorter than subject: 57 - 246
Fln protein:
M
Protein Length:
58
Fln nts:
A
Fln Alignment:
G5KS2UX02FI0KT___MYYTCMVDLYGRAGKLEDAENIIERMPFKPNAVIWQTLLGACRVHGNMEIGKHAAEC
D5AAE0_______________VHYACMIDLLGRAGRLDEARDFMKTIPFAPDANVWGALLGACRMYGNIDLGKHAAEC
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
