|
||||||
|
UniGene Name: sp_v3.0_unigene65039
Length: 229 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene65039
A |
|
Ace file of the UniGene sp_v3.0_unigene65039
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Serine/threonine-protein kinase PBS1, putative n=1 Tax=Ricinus communis RepID=B9RQP5_RICCO | - | - | 5.0e-10 | 65% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 65% |
| Source | Gene names |
|---|---|
| Sma3 | APK1A; APK2b; At1g07570; At1g26150; At1g68690; At2g02800; At2g02800/T20F6.6; At2g33580; At2g33580/F4P9.35; At2g41970; At5g02290; F22G5.5; F24J5.8; F28B23.17; F5A18.8; GSVIVT00002969001; GSVIVT00017351001; GSVIVT00020114001; GSVIVT00030240001; GSVIVT000370 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | cell wall macromolecule catabolic process | GO:0016998 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Serine-threonine/tyrosine-protein kinase catalytic domain | IPR001245 | - | 0.0 | - |
| Sma3 | Bulb-type lectin domain | IPR001480 | - | 0.0 | - |
| Sma3 | Peptidoglycan-binding Lysin subgroup | IPR002482 | - | 0.0 | - |
| Sma3 | Gnk2-homologous domain | IPR002902 | - | 0.0 | - |
| Sma3 | Apple-like | IPR003609 | - | 0.0 | - |
| Sma3 | Tyrosine-protein kinase, active site | IPR008266 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | PAN-2 domain | IPR013227 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - | |
| Sma3 | Peptidoglycan-binding lysin domain | IPR018392 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G49270.1 | Protein kinase superfamily protein chr1:18227334-18230227 REVERSE LENGTH=699 | 2.0e-13 | 52% |
| RefSeq | Arabidopsis thaliana | NP_175353.1 | protein kinase-like protein [Arabidopsis thaliana] | 3.0e-13 | 52% |
| RefSeq | Populus trichocarpa | XP_002307830.1 | predicted protein, partial [Populus trichocarpa] | 3.0e-13 | 72% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LQ73
Fln msg: Distance to subject end: 93 aas, your sequence is shorter than subject: 75 - 536
Fln protein:
C
Protein Length:
76
Fln nts:
A
Fln Alignment:
G5KS2UX02IMX1N___QRIVGTQGYMAPEYVANGVIT*KTDVFSFGVVLLELLSGQ
B8LQ73_______________KHIMGTQGYMAPEYLADGFVSPKLDVFAFGVVLLEMISGK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
