UniGene Name: sp_v3.0_unigene65038
Length: 226 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene65038
A |
Ace file of the UniGene sp_v3.0_unigene65038
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Unassigned protein | - | - | 0.0 | - |
| FL-Next | Isoform 1 of Topless-related protein 1 OS=Arabidopsis thaliana GN=TPR1 | - | - | 0.0 | 81% |
| Sma3 | WD-repeat protein, putative | - | - | 5.954e-12 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT3G15880; At1g15750; At1g80490; At3g15880; At5g27030; CTV.2; F15P11.3; F7H2.9; GSVIVT00000315001; GSVIVT00003228001; GSVIVT00014065001; GSVIVT00016938001; GSVIVT00022669001; GSVIVT00032753001; LOC_Os03g14980; MtrDRAFT_AC147963g18v2; OJ1115_B04.1; Os01g02 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | transcription repressor activity | GO:0016564 | Molecular Function | 0.0 | - |
| Sma3 | protein homodimerization activity | GO:0042803 | Molecular Function | 0.0 | - |
| Sma3 | apoptotic process | GO:0006915 | Biological Process | 0.0 | - |
| Sma3 | response to auxin stimulus | GO:0009733 | Biological Process | 0.0 | - |
| Sma3 | xylem and phloem pattern formation | GO:0010051 | Biological Process | 0.0 | - |
| Sma3 | primary shoot apical meristem specification | GO:0010072 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Histidine phosphatase superfamily, clade-2 | IPR000560 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
| Sma3 | WD40 repeat | IPR001680 | - | 0.0 | - |
| Sma3 | NB-ARC | IPR002182 | - | 0.0 | - |
| Sma3 | LisH dimerisation motif | IPR006594 | - | 0.0 | - |
| Sma3 | CTLH, C-terminal LisH motif | IPR006595 | - | 0.0 | - |
| Sma3 | LisH dimerisation motif, subgroup | IPR013720 | - | 0.0 | - |
| Sma3 | WD40/YVTN repeat-like-containing domain | IPR015943 | - | 0.0 | - |
| Sma3 | F-box associated interaction domain | IPR017451 | - | 0.0 | - |
| Sma3 | WD40-repeat-containing domain | IPR017986 | - | 0.0 | - |
| Sma3 | Cytochrome b5, heme-binding site | IPR018506 | - | 0.0 | - |
| Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
| Sma3 | IPR019782 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G80490.2 | TPR1 TOPLESS-related 1 chr1:30261094-30266446 REVERSE LENGTH=1120 | 1.0e-19 | 84% |
| RefSeq | Arabidopsis thaliana | NP_178164.3 | Topless-related protein 1 [Arabidopsis thaliana] | 2.0e-19 | 84% |
| RefSeq | Populus trichocarpa | XP_002327405.1 | predicted protein [Populus trichocarpa] | 8.0e-21 | 88% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q0WV90-1
Fln msg: Warning!, your query overlaps and the subject is separated, Distance to subject end: 256 aas, your sequence is shorter than subject: 75 - 1119
Fln protein:
C
Protein Length:
76
Fln nts:
A
Fln Alignment:
G5KS2UX02G41FH___RSLGVVQFDTTRNRFLAAGDEFQIKFWDMIQIQxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDTNPEEAAACIALSKNDSYVMSASGGKVSLFNMMTFKVMTTFMPP
Q0WV90-1_____________RSLGVVQFDTTKNRYLAAGDDFSIKFWDMDTIQxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxETNPEEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMATFMPP

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta