|
||||||
|
UniGene Name: sp_v3.0_unigene65030
Length: 130 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene65030
T |
|
Ace file of the UniGene sp_v3.0_unigene65030 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Ubiquitin-activating enzyme E1 n=1 Tax=Sorghum bicolor RepID=C5WNH5_SORBI | - | - | 2.0e-10 | 78% |
| FL-Next | sp=Ubiquitin-activating enzyme E1 2; Triticum aestivum (Wheat). | - | - | 0.0 | 77% |
| Sma3 | Ubiquitin-activating enzyme E1 | - | - | 1.091e-25 | - |
| Source | Gene names |
|---|---|
| Sma3 | At2g30110; At5g06460; GSVIVT00001293001; GSVIVT00024047001; LOC_Os03g18380; LOC_Os11g01510; Os03g0294900; Os07g0692900; Os11g0106400; OsI_27435; OsI_34806; OsI_37167; OsJ_10472; OsJ_25682; OsJ_34931; P0034A04.123; POPTRDRAFT_557633; POPTRDRAFT_722604; POP |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
| Sma3 | ubiquitin-protein ligase activity | GO:0004842 | Molecular Function | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | small protein activating enzyme activity | GO:0008641 | Molecular Function | 0.0 | - |
| Sma3 | ligase activity | GO:0016874 | Molecular Function | 0.0 | - |
| Sma3 | protein modification process | GO:0006464 | Biological Process | 0.0 | - |
| Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
| Sma3 | protein ubiquitination | GO:0016567 | Biological Process | 0.0 | - |
| Sma3 | modification-dependent protein catabolic process | GO:0019941 | Biological Process | 0.0 | - |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Sma3 | response to other organism | GO:0051707 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ubiquitin/SUMO-activating enzyme E1 | IPR000011 | - | 0.0 | - |
| Sma3 | Ubiquitin-activating enzyme repeat | IPR000127 | - | 0.0 | - |
| Sma3 | UBA/THIF-type NAD/FAD binding fold | IPR000594 | - | 0.0 | - |
| Sma3 | RNA polymerase, alpha subunit | IPR000722 | - | 0.0 | - |
| Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
| Sma3 | Ubiquitin-activating enzyme, E1, active site | IPR018074 | - | 0.0 | - |
| Sma3 | Ubiquitin-activating enzyme, E1 | IPR018075 | - | 0.0 | - |
| Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
| Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G30110.1 | ATUBA1, MOS5, UBA1 ubiquitin-activating enzyme 1 chr2:12852632-12857369 REVERSE LENGTH=1080 | 5.0e-13 | 70% |
| RefSeq | Arabidopsis thaliana | NP_565693.1 | ubiquitin-activating enzyme E1 1 [Arabidopsis thaliana] | 6.0e-13 | 70% |
| RefSeq | Populus trichocarpa | XP_002313232.1 | predicted protein, partial [Populus trichocarpa] | 2.0e-13 | 72% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: P31251
Fln msg: Distance to subject end: 633 aas, your sequence is shorter than subject: 43 - 1051
Fln protein:
I
Protein Length:
44
Fln nts:
T
Fln Alignment:
G5KS2UX02HO4EP___VLKHFASGHCAVLNSMETMFGGIVGREVVKSCSGKFHPLY
P31251_______________LLHHFASGSRAVLNPMAAMFGGIVGQEVVKACSGKFHPLY
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
