SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene64897

Length: 154 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>sp_v3.0_unigene64897
ATCAACTGCAAATGGGTGTATAAAGTGAAATACAAAGCTGACGGAACCCTAGACAAGTATAAAGCTCGTCTTGTTGCTCGAGGGTTCTCACAAAAGGAAGGCATTGACTATGAAGAGACCTTTGCTCCTACAACCAAGATGAGTACCATACATT

Ace file of the UniGene sp_v3.0_unigene64897 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Orf490 protein n=4 Tax=Oryza RepID=Q8HCR1_ORYSJ	-	-	4.0e-15	72%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	66%
Sma3	Retrotransposon protein, putative, Ty1-copia subclass	-	-	2.205e-36	-

Source	Gene names
Sma3	60I2G14; AT4g22040; At2g04490; B0809H07.1; B1003C08.12; B1065G12.28; BA4; LOC_Os03g06540; LOC_Os03g20080; LOC_Os03g24620; LOC_Os03g30860; LOC_Os03g36610; LOC_Os03g56990; LOC_Os03g64080; LOC_Os10g04640; LOC_Os10g18440; LOC_Os10g29650; LOC_Os10g30510; LOC_O

Source	GOs	Term	Type	Identity
Sma3	nuclear pore	GO:0005643	Cellular Component	-
Sma3	cytoplasm	GO:0005737	Cellular Component	-
Sma3	mitochondrion	GO:0005739	Cellular Component	-
Sma3	CCAAT-binding factor complex	GO:0016602	Cellular Component	-
Sma3	nucleic acid binding	GO:0003676	Molecular Function	-
Sma3	DNA binding	GO:0003677	Molecular Function	-
Sma3	sequence-specific DNA binding transcription factor activity	GO:0003700	Molecular Function	-
Sma3	RNA binding	GO:0003723	Molecular Function	-
Sma3	RNA-directed DNA polymerase activity	GO:0003964	Molecular Function	-
Sma3	monooxygenase activity	GO:0004497	Molecular Function	-
Sma3	iron ion binding	GO:0005506	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	zinc ion binding	GO:0008270	Molecular Function	-
Sma3	protein transporter activity	GO:0008565	Molecular Function	-
Sma3	electron carrier activity	GO:0009055	Molecular Function	-
Sma3	oxidoreductase activity	GO:0016491	Molecular Function	-
Sma3	ATPase activity	GO:0016887	Molecular Function	-
Sma3	heme binding	GO:0020037	Molecular Function	-
Sma3	iron-sulfur cluster binding	GO:0051536	Molecular Function	-
Sma3	protein import into nucleus, docking	GO:0000059	Biological Process	-
Sma3	RNA-dependent DNA replication	GO:0006278	Biological Process	-
Sma3	regulation of transcription, DNA-dependent	GO:0006355	Biological Process	-
Sma3	DNA integration	GO:0015074	Biological Process	-
Sma3	oxidation-reduction process	GO:0055114	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	ATPase, F1/V1/A1 complex, alpha/beta subunit, nucleotide-binding domain	IPR000194	-	-
Sma3	Reverse transcriptase	IPR000477	-	-
Sma3	Cytochrome P450	IPR001128	-	-
Sma3	CCAAT-binding transcription factor, subunit B	IPR001289	-	-
Sma3	4Fe-4S binding domain	IPR001450	-	-
Sma3	Importin-beta, N-terminal	IPR001494	-	-
Sma3	Integrase, catalytic core	IPR001584	-	-
Sma3	Zinc finger, CCHC-type	IPR001878	-	-
Sma3	Ankyrin repeat	IPR002110	-	-
Sma3	Phosphotransferase system, HPr serine phosphorylation site	IPR002114	-	-
Sma3	Chaperonin TCP-1, conserved site	IPR002194	-	-
Sma3	Cytochrome P450, E-class, group I	IPR002401	-	-
Sma3	ABC transporter-like	IPR003439	-	-
Sma3	AAA+ ATPase domain	IPR003593	-	-
Sma3	Retrotransposon gag protein	IPR005162	-	-
Sma3	Sugar transporter, conserved site	IPR005829	-	-
Sma3	Uncharacterised protein family Cys-rich	IPR006461	-	-
Sma3	CS-like domain	IPR007052	-	-
Sma3	RNase L inhibitor RLI, possible metal-binding domain	IPR007209	-	-
Sma3	Armadillo-like helical	IPR011989	-	-
Sma3		IPR013084	-	-
Sma3	Reverse transcriptase, RNA-dependent DNA polymerase	IPR013103	-	-
Sma3	Alcohol dehydrogenase, C-terminal	IPR013149	-	-
Sma3	ABC transporter, ABCE	IPR013283	-	-
Sma3	Exportin-1/Importin-beta-like	IPR013598	-	-
Sma3	CRM1 C-terminal domain	IPR014877	-	-
Sma3	NAD(P)-binding domain	IPR016040	-	-
Sma3	CS domain	IPR017447	-	-
Sma3	ABC transporter, conserved site	IPR017871	-	-
Sma3	4Fe-4S ferredoxin-type, iron-sulpur binding domain	IPR017896	-	-
Sma3	4Fe-4S ferredoxin, iron-sulphur binding, conserved site	IPR017900	-	-
Sma3	Cytochrome P450, conserved site	IPR017972	-	-
Sma3		IPR017973	-	-
Sma3	CCAAT-binding factor, conserved site	IPR018362	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT4G23160.1	CRK8 cysteine-rich RLK (RECEPTOR-like protein kinase) 8 chr4:12129485-12134086 FORWARD LENGTH=1262	3.0e-18	60%
RefSeq	Arabidopsis thaliana	NP_194047.2	cysteine-rich receptor-like protein kinase 8 [Arabidopsis thaliana]	4.0e-18	60%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: B8LKV8

Fln msg: Distance to subject end: 287 aas, your sequence is shorter than subject: 51 - 363

Fln protein: INCKWVYKVKYKADGTLDKYKARLVARGFSQKEGIDYEETFAPTTKMSTIH

Protein Length: 52

Fln nts: ATCAACTGCAAATGGGTGTATAAAGTGAAATACAAAGCTGACGGAACCCTAGACAAGTATAAAGCTCGTCTTGTTGCTCGAGGGTTCTCACAAAAGGAAGGCATTGACTATGAAGAGACCTTTGCTCCTACAACCAAGATGAGTACCATACATT

Fln Alignment:

G5KS2UX02HMQ4L___INCKWVYKVKYKADGTLDKYKARLVARGFSQKEGIDYEETFAPTTKMSTI
B8LKV8_______________ISVKWVYKTKYKANGELDKHKARLVAKGFAQEYGVDYNETFAPVARLDTI

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain