|
||||||
|
UniGene Name: sp_v3.0_unigene64883
Length: 213 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene64883
T |
|
Ace file of the UniGene sp_v3.0_unigene64883 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Pentatricopeptide repeat protein (Fragment) n=1 Tax=Picea abies RepID=B3U1V1_PICAB | - | - | 2.0e-21 | 72% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 66% |
| Sma3 | Pentatricopeptide repeat protein | - | - | 0.0 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g20230; At1g25360; At1g47580; At1g56690; At2g22070; At3g57430; At3g61170; At4g14850; At4g16835; At4g33170; At5g16860; B1032F05.19; DYW10; F16N3.14; F25P12.87; F2K13_10; F4F7.25; F4I10.100; FCAALL.335; FCAALL.441; GSVIVT00000307001; GSVIVT00003383001; G |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | ribosome | GO:0005840 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | nucleotide binding | GO:0000166 | Molecular Function | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | structural constituent of ribosome | GO:0003735 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | deaminase activity | GO:0019239 | Molecular Function | 0.0 | - |
| Sma3 | DNA methylation | GO:0006306 | Biological Process | 0.0 | - |
| Sma3 | translation | GO:0006412 | Biological Process | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | purine ribonucleoside monophosphate biosynthetic process | GO:0009168 | Biological Process | 0.0 | - |
| Sma3 | thiamine biosynthetic process | GO:0009228 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Legume lectin domain | IPR001220 | - | 0.0 | - |
| Sma3 | Ribosomal protein S3, C-terminal | IPR001351 | - | 0.0 | - |
| Sma3 | Adenosine/AMP deaminase domain | IPR001365 | - | 0.0 | - |
| Sma3 | C-5 cytosine methyltransferase | IPR001525 | - | 0.0 | - |
| Sma3 | Thiamine biosynthesis protein ThiC | IPR002817 | - | 0.0 | - |
| Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
| Sma3 | Immunoglobulin/major histocompatibility complex, conserved site | IPR003006 | - | 0.0 | - |
| Sma3 | K Homology domain, type 2 | IPR004044 | - | 0.0 | - |
| Sma3 | K Homology domain | IPR004087 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - | |
| Sma3 | IPR018115 | - | 0.0 | - | |
| Sma3 | Asp/Glu racemase, active site | IPR018187 | - | 0.0 | - |
| Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G47580.1 | Pentatricopeptide repeat (PPR) superfamily protein chr1:17485668-17486387 FORWARD LENGTH=239 | 1.0e-24 | 57% |
| RefSeq | Arabidopsis thaliana | NP_175189.2 | putative lipoyltransferase [Arabidopsis thaliana] | 2.0e-24 | 57% |
| RefSeq | Populus trichocarpa | XP_002303374.1 | predicted protein [Populus trichocarpa] | 5.0e-24 | 65% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9P0W0
Fln msg: Distance to subject end: 29 aas, your sequence is shorter than subject: 70 - 370
Fln protein:
R
Protein Length:
71
Fln nts:
T
Fln Alignment:
G5KS2UX02JAEKR___RMKEAGYVPDSKFALLHDVGEEYKKDVLSHHSEKLALAFGLMNTPSGTTIQIIKNLRVCGDCHTAFKFI
A9P0W0_______________QMKAAGYIPNTNF-VLHDVEEEQKEWILGHHSEKLAIAFGIISTPPGTTIRVVKNLRVCGDCHTATKFI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
