|
||||||
|
UniGene Name: sp_v3.0_unigene64852
Length: 172 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene64852
A |
|
Ace file of the UniGene sp_v3.0_unigene64852
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | cysteine-rich receptor-like protein kinase 13 [Arabidopsis thaliana] sp|Q0PW40.1|CRK13_ARATH RecName: Full=Cysteine-rich receptor-like protein kinase 13; Short=Cysteine-rich RLK13; Flags: Precursor gb|ABG74916.1| cysteine-rich receptor-like kinase 13 [Ara | - | - | 1.0e-15 | 67% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 74% |
| Sma3 | Putative serine/threonine kinase protein | - | - | 1.873e-14 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Non-specific protein-tyrosine kinase. | EC:2.7.10.2 | - | 5.613e-08 | - |
| Sma3 | Transferases, Transferring phosphorous-containing groups, Protein-serine/threonine kinases. | EC:2.7.11.- | - | 3.834e-06 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT4g03230; AT4g27290; AT4g27300; At1g61610; At4g03230; At4g04500; At4g05200; At4g23210; At4g23240; At4g27290; At4g27300; B0808H03.2; B1070A12.12; B1100D10.43; C17L7.120; C6L9.3; CRK13; CRK16; CRK25; CRK37; F21P8.100; F21P8.130; F4C21.16; GSVIVT00004456001 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
| Sma3 | signal transducer activity | GO:0004871 | Molecular Function | 0.0 | - |
| Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
| Sma3 | response to molecule of bacterial origin | GO:0002237 | Biological Process | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | response to light stimulus | GO:0009416 | Biological Process | 0.0 | - |
| Sma3 | plant-type hypersensitive response | GO:0009626 | Biological Process | 0.0 | - |
| Sma3 | defense response to bacterium | GO:0042742 | Biological Process | 0.0 | - |
| Sma3 | recognition of pollen | GO:0048544 | Biological Process | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G23210.3 | - | 1.0e-20 | 67% |
| RefSeq | Arabidopsis thaliana | NP_849427.1 | cysteine-rich receptor-like protein kinase 13 [Arabidopsis thaliana] | 1.0e-20 | 67% |
| RefSeq | Populus trichocarpa | XP_002336757.1 | predicted protein, partial [Populus trichocarpa] | 1.0e-21 | 64% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NQB9
Fln msg: Distance to subject end: 201 aas, your sequence is shorter than subject: 57 - 290
Fln protein:
M
Protein Length:
58
Fln nts:
A
Fln Alignment:
G5KS2UX02G7K1H___MYEYMPNNSLDKILF--ERCRILDWQKRYNIILGVARGLLYLHEDSQPRIIHRDIKAGN
A9NQB9_______________VYEYLPNKSLDKLLFNPERRKVLDWQKRYNIIIGVARGLLYLHQDSQLRIIHRDVKVNN
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
