UniGene Name: sp_v3.0_unigene64849
Length: 147 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense) |
---|
>sp_v3.0_unigene64849
G |
Ace file of the UniGene sp_v3.0_unigene64849 (antisense) |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] sp|Q9LND4.1|PPR14_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g06140, mitochondrial; Flags: Precursor gb|AAF80137.1|AC024174_19 Contains similarity to a hypothetical | - | - | 1.0e-12 | 65% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 78% |
Sma3 | Pentatricopeptide (PPR) repeat-containing protein-like | - | - | 6.859e-12 | - |
Source | Gene names |
---|---|
Sma3 | At1g06140; At1g28690; At3g11460; At4g02750; B1045D11.23; F1K23.11; F24K9.13; GSVIVT00006467001; GSVIVT00006499001; GSVIVT00006853001; GSVIVT00017247001; GSVIVT00017804001; GSVIVT00018049001; GSVIVT00020997001; GSVIVT00021011001; GSVIVT00021552001; GSVIVT0 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | diacylglycerol kinase activity | GO:0004143 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | deaminase activity | GO:0019239 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | activation of protein kinase C activity by G-protein coupled receptor protein signaling pathway | GO:0007205 | Biological Process | 0.0 | - |
Sma3 | purine ribonucleoside monophosphate biosynthetic process | GO:0009168 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ribonuclease P | IPR000100 | - | 0.0 | - |
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Diacylglycerol kinase, accessory domain | IPR000756 | - | 0.0 | - |
Sma3 | Diacylglycerol kinase, catalytic domain | IPR001206 | - | 0.0 | - |
Sma3 | Serine-threonine/tyrosine-protein kinase catalytic domain | IPR001245 | - | 0.0 | - |
Sma3 | Adenosine/AMP deaminase domain | IPR001365 | - | 0.0 | - |
Sma3 | Heat shock protein DnaJ, N-terminal | IPR001623 | - | 0.0 | - |
Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | Asp/Glu racemase, active site | IPR018187 | - | 0.0 | - |
Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G06140.1 | Pentatricopeptide repeat (PPR) superfamily protein chr1:1864796-1866472 FORWARD LENGTH=558 | 2.0e-17 | 65% |
RefSeq | Arabidopsis thaliana | NP_172104.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 2.0e-17 | 65% |
RefSeq | Populus trichocarpa | XP_002329756.1 | predicted protein [Populus trichocarpa] | 8.0e-18 | 63% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5ADG9
Fln msg: Distance to subject end: 215 aas, your sequence is shorter than subject: 48 - 312
Fln protein:
S
Protein Length:
49
Fln nts:
G
Fln Alignment:
G5KS2UX02H76II___SACSHAGLVDKGWQYFDCMTREYSITPAEEHYACMVDLLGRAGHLNE
D5ADG9_______________SACSHAGLVDEGWKCYNCMTLDYAITPTVEHYACMVDLLGRAGHLNE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain