UniGene Name: sp_v3.0_unigene64803
Length: 125 nt
UniGene Fasta |
---|
>sp_v3.0_unigene64803
A |
Ace file of the UniGene sp_v3.0_unigene64803 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Calcium dependent protein kinase 5 n=3 Tax=Malpighiales RepID=B9HPN3_POPTR | - | - | 3.0e-10 | 89% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 55% |
Sma3 | Calcium dependent protein kinase | - | - | 1.954e-09 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Non-specific serine/threonine protein kinase. | EC:2.7.11.1 | - | 1.18e-11 | - |
Source | Gene names |
---|---|
Sma3 | At2g17290; At4g35310; At4g38230; CDPK; CDPK1; CDPK12; CDPK2; CDPK3; CDPK4; CDPK5; CPK; CPK11; CPK2; CPK26; CPK4; CPK5; CPK6; F20D10.350; F23E12.130; F5J6.13; GSVIVT00036285001; LOC_Os03g03660; OJ1149_C12.18; OSJNBa0013K16.2; Os01g0622600; Os02g0685900; Os |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | abscisic acid mediated signaling pathway | GO:0009738 | Biological Process | 0.0 | - |
Sma3 | regulation of stomatal movement | GO:0010119 | Biological Process | 0.0 | - |
Sma3 | regulation of anion channel activity | GO:0010359 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Calcium-binding EF-hand | IPR002048 | - | 0.0 | - |
Sma3 | Serine/threonine- / dual-specificity protein kinase, catalytic domain | IPR002290 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | EF-hand-like domain | IPR011992 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
Sma3 | EF-hand | IPR018248 | - | 0.0 | - |
Sma3 | EF-HAND 2 | IPR018249 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G17290.1 | CPK6, ATCDPK3, ATCPK6 Calcium-dependent protein kinase family protein chr2:7517005-7519239 FORWARD LENGTH=544 | 8.0e-13 | 86% |
RefSeq | Arabidopsis thaliana | NP_565411.2 | Calcium-dependent protein kinase family protein [Arabidopsis thaliana] | 1.0e-12 | 86% |
RefSeq | Populus trichocarpa | XP_002328137.1 | calcium dependent protein kinase 6 [Populus trichocarpa] | 4.0e-13 | 89% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PQ38
Fln msg: Distance to subject end: 249 aas, your sequence is shorter than subject: 41 - 529
Fln protein:
M
Protein Length:
42
Fln nts:
A
Fln Alignment:
G5KS2UX02JLKSA___CSTIFFWAETQQGIFDAVLRGYIDFDSEPWPTIS
C0PQ38_______________CGVPPFWAESEQGVAQAILRGFVDFKREPWPKIS
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain