UniGene Name: sp_v3.0_unigene64787
Length: 219 nt
UniGene Fasta |
---|
>sp_v3.0_unigene64787
A |
Ace file of the UniGene sp_v3.0_unigene64787 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | putative cyclin-dependent protein kinase [Arabidopsis thaliana] gb|AAO64868.1| At5g50860 [Arabidopsis thaliana] | - | - | 1.0e-12 | 55% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 42% |
Sma3 | Serine/threonine-protein kinase cdk9, putative | - | - | 3.963e-08 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | [RNA-polymerase]-subunit kinase. | EC:2.7.11.23 | - | 2.193e-09 | - |
Source | Gene names |
---|---|
Sma3 | AT5G44290; At1g33770; At1g53050; At1g74330; At5g44290; CDC2CAt; F14M2.11; F14O23.1; F1M20.1; F26A9.10; GSVIVT00018593001; GSVIVT00021856001; GSVIVT00023499001; GSVIVT00025069001; GSVIVT00027689001; GSVIVT00028296001; GSVIVT00035300001; MtrDRAFT_AC140549g6 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | transporter activity | GO:0005215 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | kinase activity | GO:0016301 | Molecular Function | 0.0 | - |
Sma3 | protein dimerization activity | GO:0046983 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
Sma3 | cell division | GO:0051301 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Serine/threonine- / dual-specificity protein kinase, catalytic domain | IPR002290 | - | 0.0 | - |
Sma3 | Zinc finger, BED-type predicted | IPR003656 | - | 0.0 | - |
Sma3 | General substrate transporter | IPR005828 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | HAT dimerisation | IPR008906 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G50860.1 | Protein kinase superfamily protein chr5:20693778-20696983 REVERSE LENGTH=580 | 5.0e-17 | 55% |
RefSeq | Arabidopsis thaliana | NP_199899.1 | protein kinase family protein [Arabidopsis thaliana] | 7.0e-17 | 55% |
RefSeq | Populus trichocarpa | XP_002312751.1 | predicted protein, partial [Populus trichocarpa] | 4.0e-17 | 60% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NXN0
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 198 aas, your sequence is shorter than subject: 64 - 575
Fln protein:
N
Protein Length:
65
Fln nts:
A
Fln Alignment:
G5KS2UX02HLF3V___IEPGHRGEASGALKSEFFTTEPLSCDPSSLPKYPPSKEFDAKLRAQRNKK
A9NXN0_______________LDPSQRICAKDALDAEYFWTDPVPCAPSSLPRYEPSHDFQTKRKRQQQRQ
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain