UniGene Name: sp_v3.0_unigene64780
Length: 204 nt
![]() |
---|
>sp_v3.0_unigene64780
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | E3 ubiquitin-protein ligase SINAT5 n=1 Tax=Arabidopsis thaliana RepID=SINA5_ARATH | - | - | 4.0e-28 | 92% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 98% |
Sma3 | Chromosome undetermined scaffold_203, whole genome shotgun sequence | - | - | 1.173e-08 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ligases, Forming carbon-nitrogen bonds, Acid--D-amino-acid ligases (peptide synthases). | EC:6.3.2.- | - | 3.833e-06 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Tryptophan metabolism | 00380 | 3.833e-06 | % | |
Sma3 | Biosynthesis of siderophore group nonribosomal peptides | 01053 | 3.833e-06 | % |
Source | Gene names |
---|---|
Sma3 | At2g41980; At3g58040; At3g61790; At4g27880; At5g53360; F15G16.180; GSVIVT00006731001; GSVIVT00008618001; GSVIVT00008619001; GSVIVT00008620001; GSVIVT00008621001; GSVIVT00024729001; GSVIVT00025405001; GSVIVT00031016001; GSVIVT00037258001; K19E1.16; LOC_Os0 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | ubiquitin-protein ligase activity | GO:0004842 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | ubiquitin-dependent protein catabolic process | GO:0006511 | Biological Process | 0.0 | - |
Sma3 | multicellular organismal development | GO:0007275 | Biological Process | 0.0 | - |
Sma3 | protein ubiquitination | GO:0016567 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | F-box domain, cyclin-like | IPR001810 | - | 0.0 | - |
Sma3 | Zinc finger, RING-type | IPR001841 | - | 0.0 | - |
Sma3 | Seven-in-absentia protein, sina | IPR004162 | - | 0.0 | - |
Sma3 | Zinc finger, SIAH-type | IPR013010 | - | 0.0 | - |
Sma3 | TRAF-type | IPR013322 | - | 0.0 | - |
Sma3 | Seven In Absentia Homolog-type | IPR013323 | - | 0.0 | - |
Sma3 | Aldehyde dehydrogenase domain | IPR015590 | - | 0.0 | - |
Sma3 | Zinc finger, C2H2-like | IPR015880 | - | 0.0 | - |
Sma3 | Aldehyde dehydrogenase, N-terminal | IPR016162 | - | 0.0 | - |
Sma3 | Zinc finger, RING-type, conserved site | IPR017907 | - | 0.0 | - |
Sma3 | Seven-in-absentia protein, TRAF-like domain | IPR018121 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G61790.1 | Protein with RING/U-box and TRAF-like domains chr3:22871974-22873543 REVERSE LENGTH=326 | 4.0e-34 | 92% |
RefSeq | Arabidopsis thaliana | NP_567118.1 | E3 ubiquitin-protein ligase SINAT3 [Arabidopsis thaliana] | 6.0e-34 | 92% |
RefSeq | Populus trichocarpa | XP_002320867.1 | predicted protein [Populus trichocarpa] | 4.0e-33 | 90% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NX30
Fln msg: Distance to subject end: 186 aas, your sequence is shorter than subject: 68 - 323
Fln protein:
N
Protein Length:
69
Fln nts:
A
Fln Alignment:
G5KS2UX02FO7MM___LYPPIHQCHNGHTLCSSCKSRVHNKCPTCRQELGDIRCLALEKVAESLELPCKHY
A9NX30_______________MYPPIHQCHNGHTLCSSCKSRVHNKCPTCRQELGDIRCLALEKVAESLELPCKHY
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain