UniGene Name: sp_v3.0_unigene64732
Length: 185 nt
UniGene Fasta |
---|
>sp_v3.0_unigene64732
A |
Ace file of the UniGene sp_v3.0_unigene64732 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Putative copia-like retrotransposon Hopscotch polyprotein n=2 Tax=Zea mays RepID=Q8W0X9_MAIZE | - | - | 2.0e-11 | 66% |
FL-Next | tr=Reverse transcriptase; Picea glauca (White spruce) (Pinus glauca). | - | - | 0.0 | 51% |
Sma3 | Retrotransposon protein, putative, Ty1-copia subclass | - | - | 1.54e-32 | - |
Source | Gene names |
---|---|
Sma3 | H0102C09.1; LOC_Os03g06540; LOC_Os03g14410; LOC_Os03g24620; LOC_Os03g30860; LOC_Os03g36684; LOC_Os03g50180; LOC_Os10g11280; LOC_Os10g13690; LOC_Os10g40800; LOC_Os11g07650; LOC_Os11g07980; LOC_Os11g40860; LOC_Os12g14740; LOC_Os12g16430; LOC_Os12g26180; LOC |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | monooxygenase activity | GO:0004497 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Sma3 | recognition of pollen | GO:0048544 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | S-locus glycoprotein | IPR000858 | - | 0.0 | - |
Sma3 | Chromo domain/shadow | IPR000953 | - | 0.0 | - |
Sma3 | Cytochrome P450 | IPR001128 | - | 0.0 | - |
Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
Sma3 | Ankyrin repeat | IPR002110 | - | 0.0 | - |
Sma3 | Cytochrome P450, E-class, group I | IPR002401 | - | 0.0 | - |
Sma3 | Retrotransposon gag protein | IPR005162 | - | 0.0 | - |
Sma3 | Putative harbinger transposase-derived nuclease | IPR006912 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | Domain of unknown function DUF1263 | IPR010685 | - | 0.0 | - |
Sma3 | IPR013084 | - | 0.0 | - | |
Sma3 | Reverse transcriptase, RNA-dependent DNA polymerase | IPR013103 | - | 0.0 | - |
Sma3 | PAN-2 domain | IPR013227 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | Cytochrome P450, conserved site | IPR017972 | - | 0.0 | - |
Sma3 | IPR017973 | - | 0.0 | - |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q9M5J7
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 34 aas, your sequence is shorter than subject: 55 - 542
Fln protein:
C
Protein Length:
56
Fln nts:
A
Fln Alignment:
G5KS2UX02HXDKY___GNPDDRRSTSGYAFHIGSGVVSWISKKQPTVSLSSTESEYKALTNAT
Q9M5J7_______________GDLDHIRSTSGYVFNLFGGAISWMSKIQALVALSTTEAEYMVATHAS
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain