UniGene Name: sp_v3.0_unigene64723
Length: 221 nt
UniGene Fasta |
---|
>sp_v3.0_unigene64723
G |
Ace file of the UniGene sp_v3.0_unigene64723 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | putative ammonium transporter [Camellia sinensis] | - | - | 5.0e-13 | 80% |
FL-Next | sp=Ammonium transporter 1 member 3; Solanum lycopersicum (Tomato) (Lycopersicon esculentum). | - | - | 0.0 | 77% |
Sma3 | Ammonium transporter | - | - | 3.528e-33 | - |
Source | Gene names |
---|---|
Sma3 | AMT1; AMT1.1; AMT1.2; AMT1.3; AMT1.4; Amt1; At1g64780; At3g24290; At3g24300; At4g13510; At4g28700; CsAMT1; F13O11.9; F16A16.190; GSVIVT00020387001; GSVIVT00024113001; K7M2.6; OJ1234_B11.1; OJ1234_B11.3; OJ1372_D06.26; OJ1372_D06.28; OSIGBa0157K09-H0214G12 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | actin binding | GO:0003779 | Molecular Function | 0.0 | - |
Sma3 | ammonium transmembrane transporter activity | GO:0008519 | Molecular Function | 0.0 | - |
Sma3 | high affinity secondary active ammonium transmembrane transporter activity | GO:0015398 | Molecular Function | 0.0 | - |
Sma3 | hydrolase activity, acting on ester bonds | GO:0016788 | Molecular Function | 0.0 | - |
Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
Sma3 | cytoskeleton organization | GO:0007010 | Biological Process | 0.0 | - |
Sma3 | response to nematode | GO:0009624 | Biological Process | 0.0 | - |
Sma3 | ammonium transport | GO:0015696 | Biological Process | 0.0 | - |
Sma3 | methylammonium transport | GO:0015843 | Biological Process | 0.0 | - |
Sma3 | protein polymerization | GO:0051258 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ammonium transporter | IPR001905 | - | 0.0 | - |
Sma3 | Villin headpiece | IPR003128 | - | 0.0 | - |
Sma3 | Gelsolin | IPR007122 | - | 0.0 | - |
Sma3 | Gelsolin domain | IPR007123 | - | 0.0 | - |
Sma3 | Phosphoesterase | IPR007312 | - | 0.0 | - |
Sma3 | IPR010256 | - | 0.0 | - | |
Sma3 | Ammonium transporter, conserved site | IPR018047 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G24300.1 | " AMT1;3, ATAMT1;3 ammonium transporter 1;3 chr3:8805858-8807354 REVERSE LENGTH=498" | 6.0e-14 | 76% |
RefSeq | Arabidopsis thaliana | NP_189073.1 | "ammonium transporter 1;3 [Arabidopsis thaliana]" | 7.0e-14 | 76% |
RefSeq | Populus trichocarpa | XP_002314106.1 | ammonium transporter [Populus trichocarpa] | 2.0e-18 | 81% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9FVN0
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 327 aas, your sequence is shorter than subject: 67 - 460
Fln protein:
G
Protein Length:
68
Fln nts:
G
Fln Alignment:
G5KS2UX02JPSL2___SFFALTGVPNDTYDYSYYLYQWAFAIAVAGITSGSIAERTQFGA
Q9FVN0_______________SYFALKDIPSSSYDYSFFLYQWAFAIAVAGITSGSIAERTQFTA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain