UniGene Name: sp_v3.0_unigene64635
Length: 173 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense) |
---|
>sp_v3.0_unigene64635
A |
Ace file of the UniGene sp_v3.0_unigene64635 (antisense) |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | putative beta-1,3-galactosyltransferase 6 [Arabidopsis thaliana] sp|Q9MAP8.1|B3GT6_ARATH RecName: Full=Probable beta-1,3-galactosyltransferase 6 gb|AAF31275.1|AC006424_4 Highly similar to avr9 [Arabidopsis thaliana] gb|AAP21243.1| At1g32930 [Arabidopsis t | - | - | 6.0e-15 | 83% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 79% |
Sma3 | Beta-1,3-galactosyltransferase sqv-2, putative | - | - | 1.679e-16 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Transferases, Glycosyltransferases, Hexosyltransferases. | EC:2.4.1.- | - | 1.25e-16 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Glycosaminoglycan biosynthesis - chondroitin sulfate | 00532 | 1.763e-18 | % | |
Sma3 | Glycosaminoglycan biosynthesis - heparan sulfate | 00534 | 1.763e-18 | % | |
Sma3 | Metabolic pathways | 01100 | 1.763e-18 | % |
Source | Gene names |
---|---|
Sma3 | At1g05170; At1g11730; At1g22015; At1g32930; At1g33430; At1g77810; At2g32430; At4g26940; B3GALT1; B3GALT2; B3GALT3; B3GALT4; B3GALT5; B3GALT6; B3GALT7; B3GALT8; F10C21.10; F10M23.280; F25C20.12; F28K19.2; F2E2.6; F9L11.10; GSVIVT00000488001; GSVIVT00015310 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Golgi membrane | GO:0000139 | Cellular Component | 0.0 | - |
Sma3 | Golgi apparatus | GO:0005794 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | nucleotide binding | GO:0000166 | Molecular Function | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | galactosyltransferase activity | GO:0008378 | Molecular Function | 0.0 | - |
Sma3 | manganese ion binding | GO:0030145 | Molecular Function | 0.0 | - |
Sma3 | beta-1,3-galactosyltransferase activity | GO:0048531 | Molecular Function | 0.0 | - |
Sma3 | protein glycosylation | GO:0006486 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | RNA recognition motif domain | IPR000504 | - | 0.0 | - |
Sma3 | Glycosyl transferase, family 31 | IPR002659 | - | 0.0 | - |
Sma3 | Nucleotide-binding, alpha-beta plait | IPR012677 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G32930.1 | Galactosyltransferase family protein chr1:11931980-11934399 REVERSE LENGTH=399 | 2.0e-20 | 83% |
RefSeq | Arabidopsis thaliana | NP_174569.1 | putative beta-1,3-galactosyltransferase 6 [Arabidopsis thaliana] | 3.0e-20 | 83% |
RefSeq | Populus trichocarpa | XP_002320464.1 | predicted protein [Populus trichocarpa] | 1.0e-20 | 90% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5A8P6
Fln msg: Distance to subject end: 84 aas, your sequence is shorter than subject: 57 - 246
Fln protein:
I
Protein Length:
58
Fln nts:
A
Fln Alignment:
G5KS2UX02IMITN___RGVRYQEPEYWKFGEDGNKYFRHATGQLYAISKDLATCISINT
D5A8P6_______________KGVKYHEPEYWKFGEEGNRYFRHATGQIYAISRDLATYISINS
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain