UniGene Name: sp_v3.0_unigene64606
Length: 161 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene64606
A |
Ace file of the UniGene sp_v3.0_unigene64606
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Cellulose synthase [Medicago truncatula] | - | - | 4.0e-14 | 73% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 88% |
| Sma3 | Cellulose synthase | - | - | 4.2039e-45 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Transferases, Glycosyltransferases, Hexosyltransferases. | EC:2.4.1.- | - | 5.677e-18 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Starch and sucrose metabolism | 00500 | 0.0 | % |
| Source | Gene names |
|---|---|
| Sma3 | ATHB; At1g55850; At2g32530; At2g32540; At2g32610; At2g32620; At3g03050; At4g15320; At4g18780; At4g24010; At5g05170; At5g16910; At5g17420; At5g64740; CESA1; CESA2; CESA3; CESA4; CESA5; CESA6; CESA7; CESA8; CESA9; CEV1; CSLB1; CSLB2; CSLB3; CSLB4; CSLB6; CS |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Golgi membrane | GO:0000139 | Cellular Component | 0.0 | - |
| Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
| Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
| Sma3 | endoplasmic reticulum membrane | GO:0005789 | Cellular Component | 0.0 | - |
| Sma3 | Golgi apparatus | GO:0005794 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | cellulose synthase complex | GO:0010330 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | integral to Golgi membrane | GO:0030173 | Cellular Component | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
| Sma3 | cellulose synthase (UDP-forming) activity | GO:0016760 | Molecular Function | 0.0 | - |
| Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
| Sma3 | defense response | GO:0006952 | Biological Process | 0.0 | - |
| Sma3 | response to osmotic stress | GO:0006970 | Biological Process | 0.0 | - |
| Sma3 | cellular cell wall organization | GO:0007047 | Biological Process | 0.0 | - |
| Sma3 | response to cold | GO:0009409 | Biological Process | 0.0 | - |
| Sma3 | response to water deprivation | GO:0009414 | Biological Process | 0.0 | - |
| Sma3 | primary cell wall biogenesis | GO:0009833 | Biological Process | 0.0 | - |
| Sma3 | secondary cell wall biogenesis | GO:0009834 | Biological Process | 0.0 | - |
| Sma3 | positive regulation of abscisic acid biosynthetic process | GO:0010116 | Biological Process | 0.0 | - |
| Sma3 | rhamnogalacturonan I side chain metabolic process | GO:0010400 | Biological Process | 0.0 | - |
| Sma3 | cell growth | GO:0016049 | Biological Process | 0.0 | - |
| Sma3 | cellulose biosynthetic process | GO:0030244 | Biological Process | 0.0 | - |
| Sma3 | defense response to bacterium | GO:0042742 | Biological Process | 0.0 | - |
| Sma3 | cortical microtubule organization | GO:0043622 | Biological Process | 0.0 | - |
| Sma3 | root hair elongation | GO:0048767 | Biological Process | 0.0 | - |
| Sma3 | defense response to fungus | GO:0050832 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Pyridine nucleotide-disulphide oxidoreductase, class-II | IPR000103 | - | 0.0 | - |
| Sma3 | IPR000348 | - | 0.0 | - | |
| Sma3 | WD40 repeat | IPR001680 | - | 0.0 | - |
| Sma3 | Zinc finger, RING-type | IPR001841 | - | 0.0 | - |
| Sma3 | Lipocalin | IPR002345 | - | 0.0 | - |
| Sma3 | Cellulose synthase | IPR005150 | - | 0.0 | - |
| Sma3 | GOLD | IPR009038 | - | 0.0 | - |
| Sma3 | WD40/YVTN repeat-like-containing domain | IPR015943 | - | 0.0 | - |
| Sma3 | Zinc finger, RING-type, conserved site | IPR017907 | - | 0.0 | - |
| Sma3 | WD40-repeat-containing domain | IPR017986 | - | 0.0 | - |
| Sma3 | Gonadotropin, beta subunit, conserved site | IPR018245 | - | 0.0 | - |
| Sma3 | Extracellular solute-binding protein, family 3, conserved site | IPR018313 | - | 0.0 | - |
| Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
| Sma3 | IPR019782 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G32540.1 | ATCSLB04, CSLB04, ATCSLB4 cellulose synthase-like B4 chr2:13814686-13818289 FORWARD LENGTH=755 | 2.0e-18 | 67% |
| RefSeq | Arabidopsis thaliana | NP_180813.1 | cellulose synthase-like protein B4 [Arabidopsis thaliana] | 3.0e-18 | 67% |
| RefSeq | Populus trichocarpa | XP_002302868.1 | predicted protein [Populus trichocarpa] | 8.0e-18 | 65% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LK55
Fln msg: Distance to subject end: 592 aas, your sequence is shorter than subject: 53 - 744
Fln protein:
M
Protein Length:
54
Fln nts:
A
Fln Alignment:
G5KS2UX02JRZQ8___SDPIKEPPLTVVNTVLSGLALDYPVGKLSCYVSDDGGSPITFYALLEASQFA
B8LK55_______________ADPTKEPPLTVINTVLSALALDYPVGKLSCYVSDDGGSPLTFYALLEASRFA

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta