|
||||||
|
UniGene Name: sp_v3.0_unigene64589
Length: 235 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene64589
A |
|
Ace file of the UniGene sp_v3.0_unigene64589
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | RecName: Full=Endoribonuclease Dicer homolog 1; AltName: Full=Dicer-like protein 1; Short=OsDCL1 gb|AAM52322.1|AC105363_11 Putative CAF protein [Oryza sativa Japonica Group] gb|ABF93701.1| DEAD/DEAH box helicase carpel factory, putative, expressed [Oryza | - | - | 5.0e-08 | 83% |
| FL-Next | sp=Endoribonuclease Dicer homolog 1; Oryza sativa subsp. japonica (Rice). | - | - | 0.0 | 83% |
| Source | Gene names |
|---|---|
| Sma3 | At1g01040; CAF; DCL1a; DCL1b; DCL902; GSVIVT00026189001; LOC_Os03g02970; MtrDRAFT_AC150443g32v2; OJ1705B08.11; Os03g0121800; OsI_09779; OsJ_09217; PHYPADRAFT_205895; POPTRDRAFT_552372; PpDCL1a; RCOM_1340690; SIN1; SUS1; T25K16.4; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
| Sma3 | nuclear dicing body | GO:0010445 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | double-stranded RNA binding | GO:0003725 | Molecular Function | 0.0 | - |
| Sma3 | helicase activity | GO:0004386 | Molecular Function | 0.0 | - |
| Sma3 | ribonuclease III activity | GO:0004525 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | ATP-dependent helicase activity | GO:0008026 | Molecular Function | 0.0 | - |
| Sma3 | cytokinesis | GO:0000910 | Biological Process | 0.0 | - |
| Sma3 | RNA processing | GO:0006396 | Biological Process | 0.0 | - |
| Sma3 | virus induced gene silencing | GO:0009616 | Biological Process | 0.0 | - |
| Sma3 | embryonic pattern specification | GO:0009880 | Biological Process | 0.0 | - |
| Sma3 | flower development | GO:0009908 | Biological Process | 0.0 | - |
| Sma3 | vegetative to reproductive phase transition of meristem | GO:0010228 | Biological Process | 0.0 | - |
| Sma3 | production of ta-siRNAs involved in RNA interference | GO:0010267 | Biological Process | 0.0 | - |
| Sma3 | production of lsiRNA involved in RNA interference | GO:0010599 | Biological Process | 0.0 | - |
| Sma3 | primary miRNA processing | GO:0031053 | Biological Process | 0.0 | - |
| Sma3 | mRNA cleavage involved in gene silencing by miRNA | GO:0035279 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ribonuclease III domain | IPR000999 | - | 0.0 | - |
| Sma3 | Double-stranded RNA-binding | IPR001159 | - | 0.0 | - |
| Sma3 | Helicase, C-terminal | IPR001650 | - | 0.0 | - |
| Sma3 | Argonaute/Dicer protein, PAZ | IPR003100 | - | 0.0 | - |
| Sma3 | Dicer double-stranded RNA-binding fold | IPR005034 | - | 0.0 | - |
| Sma3 | Helicase/UvrB domain | IPR006935 | - | 0.0 | - |
| Sma3 | DNA/RNA helicase, DEAD/DEAH box type, N-terminal | IPR011545 | - | 0.0 | - |
| Sma3 | Helicase, superfamily 1/2, ATP-binding domain | IPR014001 | - | 0.0 | - |
| Sma3 | IPR014021 | - | 0.0 | - | |
| Sma3 | Double-stranded RNA-binding-like | IPR014720 | - | 0.0 | - |
| Sma3 | Aldo/keto reductase, conserved site | IPR018170 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| RefSeq | Populus trichocarpa | XP_002302679.1 | dicer-like protein [Populus trichocarpa] | 7.0e-11 | 83% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q8LMR2
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 598 aas, your sequence is shorter than subject: 36 - 1883
Fln protein:
M
Protein Length:
37
Fln nts:
A
Fln Alignment:
G5KS2UX02FKZTB___MYADSSFPRKEGYLGPVEYSSYADYYRQKY
Q8LMR2_______________MNAENSFPRKEGYLGPLEYSSYADYYKQKY
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
