UniGene Name: sp_v3.0_unigene64584
Length: 227 nt
UniGene Fasta |
---|
>sp_v3.0_unigene64584
A |
Ace file of the UniGene sp_v3.0_unigene64584 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | SOS2-like protein kinase [Glycine max] | - | - | 2.0e-27 | 71% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 93% |
Sma3 | CBL-interacting serine/threonine-protein kinase, putative | - | - | 7.368e-35 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Non-specific serine/threonine protein kinase. | EC:2.7.11.1 | - | 0.0 | - |
Sma3 | Calcium/calmodulin-dependent protein kinase. | EC:2.7.11.17 | - | 3.842e-25 | - |
Source | Gene names |
---|---|
Sma3 | ACRE216; ATC401; ATPK10; At1g01140; At1g29230; At1g30270; At2g26980; At2g30360; At2g34180; At2g38490; At4g18700; At4g30960; At5g01810; At5g01820; At5g07070; At5g21222; At5g21326; At5g25110; At5g35410; At5g45810; At5g45820; At5g58380; B1131G08.36; CIPK; CI |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | cytosol | GO:0005829 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | plant-type vacuole membrane | GO:0009705 | Cellular Component | 0.0 | - |
Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | potassium channel activity | GO:0005267 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | manganese ion binding | GO:0030145 | Molecular Function | 0.0 | - |
Sma3 | potassium ion binding | GO:0030955 | Molecular Function | 0.0 | - |
Sma3 | identical protein binding | GO:0042802 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | signal transduction | GO:0007165 | Biological Process | 0.0 | - |
Sma3 | response to nutrient | GO:0007584 | Biological Process | 0.0 | - |
Sma3 | response to pH | GO:0009268 | Biological Process | 0.0 | - |
Sma3 | response to water deprivation | GO:0009414 | Biological Process | 0.0 | - |
Sma3 | response to abiotic stimulus | GO:0009628 | Biological Process | 0.0 | - |
Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
Sma3 | response to cytokinin stimulus | GO:0009735 | Biological Process | 0.0 | - |
Sma3 | response to abscisic acid stimulus | GO:0009737 | Biological Process | 0.0 | - |
Sma3 | abscisic acid mediated signaling pathway | GO:0009738 | Biological Process | 0.0 | - |
Sma3 | negative regulation of abscisic acid mediated signaling pathway | GO:0009788 | Biological Process | 0.0 | - |
Sma3 | potassium ion import | GO:0010107 | Biological Process | 0.0 | - |
Sma3 | stomatal movement | GO:0010118 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Serine/threonine- / dual-specificity protein kinase, catalytic domain | IPR002290 | - | 0.0 | - |
Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
Sma3 | NAF domain | IPR004041 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
Sma3 | NAF/FISL domain | IPR018451 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G30960.1 | CIPK6, SIP3, SNRK3.14, ATCIPK6 SOS3-interacting protein 3 chr4:15067400-15068725 FORWARD LENGTH=441 | 1.0e-33 | 69% |
RefSeq | Arabidopsis thaliana | NP_194825.1 | CBL-interacting serine/threonine-protein kinase 6 [Arabidopsis thaliana] | 2.0e-33 | 69% |
RefSeq | Populus trichocarpa | XP_002316819.1 | predicted protein, partial [Populus trichocarpa] | 8.0e-35 | 71% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5A9K4
Fln msg: Distance to subject end: 163 aas, your sequence is shorter than subject: 75 - 431
Fln protein:
M
Protein Length:
76
Fln nts:
A
Fln Alignment:
G5KS2UX02GTERC___IWSCGVILFVLLAGYLPFQDANLMVMYKKIYKGDFKCPSWFSSEVQRLVLRLLDPNPRTRITVPQLMEVSWFR
D5A9K4_______________IWSCGVILFVLMAGYLPFQDANLMVMYKKIYKGDYKCPPWFSSEVRRLVLRLLDPNPRTRITVPQLMEVPWFR
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain