UniGene Name: sp_v3.0_unigene64570
Length: 192 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene64570
T |
Ace file of the UniGene sp_v3.0_unigene64570 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Os05g0319800 protein (Fragment) n=4 Tax=Oryza sativa RepID=Q0DJ73_ORYSJ | - | - | 1.0e-14 | 76% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 76% |
| Sma3 | Plasma membrane H+-ATPase | - | - | 1.157e-15 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Adenosinetriphosphatase. | EC:3.6.1.3 | - | 2.582e-08 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Purine metabolism | 00230 | 2.582e-08 | % | |
| Sma3 | Transferred entry: 3.6.3.6. | EC:3.6.1.35 | - | 6.834e-06 | - |
| Sma3 | Proton-exporting ATPase. | EC:3.6.3.6 | - | 1.813e-07 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Oxidative phosphorylation | 00190 | 1.813e-07 | % |
| Source | Gene names |
|---|---|
| Sma3 | AHA1; AHA2; AHA4; AHA6; AHA8; AHA9; AT4G30190; ATP1; Aa_42640; At1g80660; At2g07560; At3g42640; At3g47950; At4g30190; BHA-1; Cr_42640; DcPA 1; DcPA 2; DcPA 3; DcPA 4; DcPA 5; DcPA 6; F23A5.1; F9A16.7; F9N11.40; GSVIVT00000073001; GSVIVT00000438001; GSVIVT |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | hydrogen-exporting ATPase activity, phosphorylative mechanism | GO:0008553 | Molecular Function | 0.0 | - |
| Sma3 | ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism | GO:0015662 | Molecular Function | 0.0 | - |
| Sma3 | ATPase activity, uncoupled | GO:0042624 | Molecular Function | 0.0 | - |
| Sma3 | ATP biosynthetic process | GO:0006754 | Biological Process | 0.0 | - |
| Sma3 | cation transport | GO:0006812 | Biological Process | 0.0 | - |
| Sma3 | proton transport | GO:0015992 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | ATPase, P-type, H+ transporting proton pump | IPR000695 | - | 0.0 | - |
| Sma3 | ATPase, P-type, K/Mg/Cd/Cu/Zn/Na/Ca/Na/H-transporter | IPR001757 | - | 0.0 | - |
| Sma3 | ATPase, P-type cation-transporter, N-terminal | IPR004014 | - | 0.0 | - |
| Sma3 | Haloacid dehalogenase-like hydrolase | IPR005834 | - | 0.0 | - |
| Sma3 | ATPase, P-type, plasma-membrane proton-efflux | IPR006534 | - | 0.0 | - |
| Sma3 | ATPase, P-type, ATPase-associated domain | IPR008250 | - | 0.0 | - |
| Sma3 | Ribosomal protein S2, conserved site | IPR018130 | - | 0.0 | - |
| Sma3 | ATPase, P-type phosphorylation site | IPR018303 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G18960.1 | AHA1, PMA, OST2, HA1 H(+)-ATPase 1 chr2:8221858-8227268 FORWARD LENGTH=949 | 8.0e-17 | 73% |
| RefSeq | Arabidopsis thaliana | NP_179486.1 | H(+)-ATPase 1 [Arabidopsis thaliana] | 1.0e-16 | 73% |
| RefSeq | Populus trichocarpa | XP_002324564.1 | autoinhibited H+ ATPase [Populus trichocarpa] | 3.0e-17 | 76% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LQS1
Fln msg: Separated hits, possible frame ERROR between 103 and 105, Distance to subject end: 333 aas, your sequence is shorter than subject: 64 - 955
Fln protein:
E
Protein Length:
65
Fln nts:
T
Fln Alignment:
G5KS2UX02G95EJ___ELIMKADGFAKVFPEHKYKIMMRLQEMKYIYGMTxGDGVNDAPALKKANIRIAVVDATDVERG
B8LQS1_______________ELIEKADGFAGVFPEHKYEIVRRLQEKKHICGMTxGDGVNDAPALKKADIGIAVADATDAARG

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)