UniGene Name: sp_v3.0_unigene64553
Length: 202 nt
![]() |
---|
>sp_v3.0_unigene64553
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Cinnamoyl CoA reductase (Fragment) n=1 Tax=Populus trichocarpa RepID=B9GMB4_POPTR | - | - | 4.0e-19 | 68% |
FL-Next | tr=Cinnamoyl-CoA reductase; Pinus taeda (Loblolly pine). | - | - | 0.0 | 61% |
Sma3 | Cinnamoyl-CoA reductase | - | - | 0.0 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Cinnamoyl-CoA reductase. | EC:1.2.1.44 | - | 2.06411e-42 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Phenylpropanoid biosynthesis | 00940 | 2.06411e-42 | % | |
Sma3 | Biosynthesis of phenylpropanoids | 01061 | 2.06411e-42 | % | |
Sma3 | Metabolic pathways | 01100 | 2.06411e-42 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 2.06411e-42 | % |
Source | Gene names |
---|---|
Sma3 | AT1G15950; At1g15950; At1g80820; CCR; CCR1; CCR2; CCR3; CCR4; CCR5; CCR6; CCR7; F23A5.17; GSVIVT00033763001; OSJNBa0029G06.4; Os06g0623300; Os09g0419200; OsI_23747; OsI_31388; OsJ_22017; OsJ_29385; P0668D04.4-1; P0668D04.4-2; P0701F11.23-1; P0701F11.23-2; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
Sma3 | 3-beta-hydroxy-delta5-steroid dehydrogenase activity | GO:0003854 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | cinnamoyl-CoA reductase activity | GO:0016621 | Molecular Function | 0.0 | - |
Sma3 | coenzyme binding | GO:0050662 | Molecular Function | 0.0 | - |
Sma3 | steroid biosynthetic process | GO:0006694 | Biological Process | 0.0 | - |
Sma3 | cellular metabolic process | GO:0044237 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | NAD-dependent epimerase/dehydratase | IPR001509 | - | 0.0 | - |
Sma3 | 3-beta hydroxysteroid dehydrogenase/isomerase | IPR002225 | - | 0.0 | - |
Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G15950.1 | CCR1, IRX4, ATCCR1 cinnamoyl coa reductase 1 chr1:5478855-5481915 FORWARD LENGTH=344 | 2.0e-21 | 60% |
RefSeq | Arabidopsis thaliana | NP_001077544.1 | cinnamoyl coa reductase 1 [Arabidopsis thaliana] | 2.0e-21 | 60% |
RefSeq | Populus trichocarpa | XP_002299259.1 | cinnamoyl CoA reductase, partial [Populus trichocarpa] | 4.0e-26 | 68% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q8VZH7
Fln msg: Distance to subject end: 215 aas, your sequence is shorter than subject: 67 - 324
Fln protein:
N
Protein Length:
68
Fln nts:
A
Fln Alignment:
G5KS2UX02JDJSS___NVDDCKYKHLRELEGAKERLELVKADILDYQSLATVIQGCQGVFHMACLLNDNPEQVIEPAVNGTRN
Q8VZH7_______________NPEDQKNAHLKQLEGAEERLTLVKADLMDYNSLLNAINGCQGVFHVASPVTDDPEEMVEPAVNGTKN
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain