UniGene Name: sp_v3.0_unigene64498
Length: 245 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense) |
---|
>sp_v3.0_unigene64498
G |
Ace file of the UniGene sp_v3.0_unigene64498 (antisense) |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Polyprotein n=2 Tax=Primula vulgaris RepID=A5X2S4_9ERIC | - | - | 2.0e-18 | 75% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 50% |
Sma3 | Retrotransposon protein, putative, unclassified | - | - | 2.123e-09 | - |
Source | Gene names |
---|---|
Sma3 | At2g14650; F23H6.1; H0124B04.16; LOC_Os03g05350; LOC_Os03g06110; LOC_Os03g10000; LOC_Os03g13350; LOC_Os10g13960; LOC_Os10g16880; LOC_Os10g21350; LOC_Os10g37610; MtrDRAFT_AC150244g37v2; MtrDRAFT_AC155896g19v2; MtrDRAFT_AC155896g21v2; MtrDRAFT_AC157777g37v2 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
Sma3 | endonuclease activity | GO:0004519 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
Sma3 | Chromo domain/shadow | IPR000953 | - | 0.0 | - |
Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
Sma3 | Peptidase aspartic, active site | IPR001969 | - | 0.0 | - |
Sma3 | Intron-encoded nuclease 2 | IPR003611 | - | 0.0 | - |
Sma3 | Exostosin-like | IPR004263 | - | 0.0 | - |
Sma3 | Retrotransposon gag protein | IPR005162 | - | 0.0 | - |
Sma3 | Sugar transporter, conserved site | IPR005829 | - | 0.0 | - |
Sma3 | Protein of unknown function DUF594 | IPR007658 | - | 0.0 | - |
Sma3 | Reverse transcriptase, RNA-dependent DNA polymerase | IPR013103 | - | 0.0 | - |
Sma3 | Retroviral aspartyl protease | IPR013242 | - | 0.0 | - |
Sma3 | Zinc finger, H2C2-type, histone UAS binding | IPR015416 | - | 0.0 | - |
Sma3 | MULE transposase domain | IPR018289 | - | 0.0 | - |
Full-Lengther Next Prediction |
---|
Fln status: Putative Complete
Fln database: coniferopsida.fasta
Fln subject: A9NWN2
Fln msg: STOP codon was not found. Distance to subject end: 14 aas, W1: There is no M at the beginning,
Fln protein:
F
Protein Length:
59
Fln nts:
G
Fln Alignment:
G5KS2UX02FTTWY___LLSAPVVLVHKKDGSWCMCPDYRELNKVTIKDKFPISVIDELLDQLHKSIY
A9NWN2_______________MYSTPIILVRINDGSYILCNNCRVLNEITIKDKFHISIVDELLDELYGTMY
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain