UniGene Name: sp_v3.0_unigene64490
Length: 164 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene64490
T |
Ace file of the UniGene sp_v3.0_unigene64490 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Cytochrome P450 monooxygenase CYP86A24 n=1 Tax=Glycine max RepID=Q2LAK8_SOYBN | - | - | 2.0e-13 | 71% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 54% |
| Sma3 | Cytochrome P450 | - | - | 6.226e-07 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Unspecific monooxygenase. | EC:1.14.14.1 | - | 1.603e-07 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Fatty acid metabolism | 00071 | 1.603e-07 | % | |
| Sma3 | Steroid hormone biosynthesis | 00140 | 1.603e-07 | % | |
| Sma3 | Caffeine metabolism | 00232 | 1.603e-07 | % | |
| Sma3 | Tryptophan metabolism | 00380 | 1.603e-07 | % | |
| Sma3 | Arachidonic acid metabolism | 00590 | 1.603e-07 | % | |
| Sma3 | Linoleic acid metabolism | 00591 | 1.603e-07 | % | |
| Sma3 | Aminobenzoate degradation | 00627 | 1.603e-07 | % | |
| Sma3 | Retinol metabolism | 00830 | 1.603e-07 | % | |
| Sma3 | Metabolism of xenobiotics by cytochrome P450 | 00980 | 1.603e-07 | % | |
| Sma3 | Drug metabolism - cytochrome P450 | 00982 | 1.603e-07 | % | |
| Sma3 | Drug metabolism - other enzymes | 00983 | 1.603e-07 | % | |
| Sma3 | Biosynthesis of alkaloids derived from shikimate pathway | 01063 | 1.603e-07 | % | |
| Sma3 | Metabolic pathways | 01100 | 1.603e-07 | % |
| Source | Gene names |
|---|---|
| Sma3 | A_IG005I10.21; At1g01600; At1g01600/F22L4_10; At1g63710; At2g45970; At4g00360; At5g58860; B0103C08-B0602B01.11; B1096A10.16; CYP86; CYP86A1; CYP86A19; CYP86A2; CYP86A20; CYP86A21; CYP86A22; CYP86A24; F22L4.14; F24D7.10; F5I10.21; GSVIVT00000440001; GSVIVT |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | monooxygenase activity | GO:0004497 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | GO:0008393 | Molecular Function | 0.0 | - | |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
| Sma3 | fatty acid metabolic process | GO:0006631 | Biological Process | 0.0 | - |
| Sma3 | suberin biosynthetic process | GO:0010345 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | RNA helicase, ATP-dependent, DEAD-box, conserved site | IPR000629 | - | 0.0 | - |
| Sma3 | Cytochrome P450 | IPR001128 | - | 0.0 | - |
| Sma3 | Cytochrome P450, E-class, group I | IPR002401 | - | 0.0 | - |
| Sma3 | Cytochrome P450, E-class, group IV | IPR002403 | - | 0.0 | - |
| Sma3 | EGF-like region, conserved site | IPR013032 | - | 0.0 | - |
| Sma3 | Cytochrome P450, conserved site | IPR017972 | - | 0.0 | - |
| Sma3 | IPR017973 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G45970.1 | CYP86A8, LCR cytochrome P450, family 86, subfamily A, polypeptide 8 chr2:18912548-18914161 REVERSE LENGTH=537 | 5.0e-16 | 64% |
| RefSeq | Arabidopsis thaliana | NP_182121.1 | cytochrome P450, family 86, subfamily A, polypeptide 8 [Arabidopsis thaliana] | 7.0e-16 | 64% |
| RefSeq | Populus trichocarpa | XP_002314117.1 | cytochrome P450 [Populus trichocarpa] | 2.0e-16 | 67% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LLC1
Fln msg: Distance to subject end: 307 aas, your sequence is shorter than subject: 54 - 528
Fln protein:
K
Protein Length:
55
Fln nts:
T
Fln Alignment:
G5KS2UX02HH6RV___KDRLLPILAQAQELHRSVDLQDLLLRLTFDNICGLAFGMDPETLSPGLPLNPY
B8LLC1_______________RGRLIPILADACSSCRIIDLQDVFMRFTFDNICNRAFGVEPCCLSPSLPSVPF

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)