UniGene Name: sp_v3.0_unigene64467
Length: 149 nt
![]() |
---|
>sp_v3.0_unigene64467
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Dicer-like protein 4 n=3 Tax=Arabidopsis RepID=DCL4_ARATH | - | - | 1.0e-10 | 68% |
FL-Next | sp=Dicer-like protein 4; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 68% |
Sma3 | Dicer-like 4 | - | - | 3.861e-09 | - |
Source | Gene names |
---|---|
Sma3 | At5g20320; DCL1507; DCL4; F5O24.210; OSIGBa0157K09-H0214G12.2; OSJNBb0065L13.5; PHYPADRAFT_86688; RCOM_0701500; SHO1; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | double-stranded RNA binding | GO:0003725 | Molecular Function | 0.0 | - |
Sma3 | ribonuclease III activity | GO:0004525 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | ATP-dependent helicase activity | GO:0008026 | Molecular Function | 0.0 | - |
Sma3 | RNA processing | GO:0006396 | Biological Process | 0.0 | - |
Sma3 | virus induced gene silencing | GO:0009616 | Biological Process | 0.0 | - |
Sma3 | vegetative phase change | GO:0010050 | Biological Process | 0.0 | - |
Sma3 | maintenance of DNA methylation | GO:0010216 | Biological Process | 0.0 | - |
Sma3 | production of ta-siRNAs involved in RNA interference | GO:0010267 | Biological Process | 0.0 | - |
Sma3 | production of lsiRNA involved in RNA interference | GO:0010599 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
Sma3 | Protease inhibitor I4, serpin | IPR000215 | - | 0.0 | - |
Sma3 | Ribonuclease III domain | IPR000999 | - | 0.0 | - |
Sma3 | Double-stranded RNA-binding | IPR001159 | - | 0.0 | - |
Sma3 | Helicase, C-terminal | IPR001650 | - | 0.0 | - |
Sma3 | Argonaute/Dicer protein, PAZ | IPR003100 | - | 0.0 | - |
Sma3 | Dicer double-stranded RNA-binding fold | IPR005034 | - | 0.0 | - |
Sma3 | DNA/RNA helicase, DEAD/DEAH box type, N-terminal | IPR011545 | - | 0.0 | - |
Sma3 | Helicase, superfamily 1/2, ATP-binding domain | IPR014001 | - | 0.0 | - |
Sma3 | IPR014021 | - | 0.0 | - | |
Sma3 | Double-stranded RNA-binding-like | IPR014720 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G20320.1 | DCL4, ATDCL4 dicer-like 4 chr5:6859571-6869068 REVERSE LENGTH=1702 | 4.0e-15 | 68% |
RefSeq | Arabidopsis thaliana | NP_197532.3 | dicer-like protein 4 [Arabidopsis thaliana] | 5.0e-15 | 68% |
RefSeq | Populus trichocarpa | XP_002308384.1 | dicer-like protein [Populus trichocarpa] | 1.0e-12 | 63% |
![]() |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: P84634
Fln msg: Distance to subject end: 1443 aas, your sequence is shorter than subject: 49 - 1702
Fln protein:
N
Protein Length:
50
Fln nts:
A
Fln Alignment:
G5KS2UX02GUBMG___SRLDRRARKIRVLVMTPDILLHNLHHCFMKMELIELLIFDECHHAQK
P84634_______________SEWEREIAANEVLVMTPQILLHNLQHCFIKMECISLLIFDECHHAQQ
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain