UniGene Name: sp_v3.0_unigene64417
Length: 145 nt
![]() |
---|
>sp_v3.0_unigene64417
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | PIN-like auxin efflux carrier n=1 Tax=Picea abies RepID=B5TXD0_PICAB | - | - | 9.0e-18 | 91% |
FL-Next | tr=PIN-like auxin efflux carrier; Picea abies (Norway spruce) (Picea excelsa). | - | - | 0.0 | 91% |
Sma3 | Auxin efflux carrier component | - | - | 2.138e-25 | - |
Source | Gene names |
---|---|
Sma3 | AEC1; AEC2; AEC3; AEH1; AGR; AGR1; AT1G23080; At1g23080; At1g70940; At1g73590; At1g77110; At2g01420; At5g57090; CS-PIN1; EIR1; F15H11.14; F22K20.18; F2I9.4; F6D5.2; GSVIVT00014302001; GSVIVT00017824001; GSVIVT00023254001; GSVIVT00023255001; GSVIVT00030482 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | lytic vacuole | GO:0000323 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | auxin efflux carrier complex | GO:0009921 | Cellular Component | 0.0 | - |
Sma3 | basal plasma membrane | GO:0009925 | Cellular Component | 0.0 | - |
Sma3 | cell surface | GO:0009986 | Cellular Component | 0.0 | - |
Sma3 | vesicle membrane | GO:0012506 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | lateral plasma membrane | GO:0016328 | Cellular Component | 0.0 | - |
Sma3 | apical part of cell | GO:0045177 | Cellular Component | 0.0 | - |
Sma3 | transporter activity | GO:0005215 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | auxin efflux transmembrane transporter activity | GO:0010329 | Molecular Function | 0.0 | - |
Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
Sma3 | pattern specification process | GO:0007389 | Biological Process | 0.0 | - |
Sma3 | gravitropism | GO:0009630 | Biological Process | 0.0 | - |
Sma3 | photomorphogenesis | GO:0009640 | Biological Process | 0.0 | - |
Sma3 | response to ethylene stimulus | GO:0009723 | Biological Process | 0.0 | - |
Sma3 | auxin mediated signaling pathway | GO:0009734 | Biological Process | 0.0 | - |
Sma3 | auxin polar transport | GO:0009926 | Biological Process | 0.0 | - |
Sma3 | longitudinal axis specification | GO:0009942 | Biological Process | 0.0 | - |
Sma3 | positive gravitropism | GO:0009958 | Biological Process | 0.0 | - |
Sma3 | xylem and phloem pattern formation | GO:0010051 | Biological Process | 0.0 | - |
Sma3 | regulation of root meristem growth | GO:0010082 | Biological Process | 0.0 | - |
Sma3 | leaf formation | GO:0010338 | Biological Process | 0.0 | - |
Sma3 | leaf shaping | GO:0010358 | Biological Process | 0.0 | - |
Sma3 | root development | GO:0048364 | Biological Process | 0.0 | - |
Sma3 | root hair initiation | GO:0048766 | Biological Process | 0.0 | - |
Sma3 | root hair elongation | GO:0048767 | Biological Process | 0.0 | - |
Sma3 | adventitious root development | GO:0048830 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Auxin efflux carrier | IPR004776 | - | 0.0 | - |
Sma3 | Mpp10 protein | IPR007151 | - | 0.0 | - |
Sma3 | Auxin efflux carrier, plant type | IPR014024 | - | 0.0 | - |
Sma3 | Superoxide dismutase, copper/zinc, binding site | IPR018152 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G73590.1 | PIN1, ATPIN1 Auxin efflux carrier family protein chr1:27659772-27662876 FORWARD LENGTH=622 | 2.0e-23 | 93% |
RefSeq | Arabidopsis thaliana | NP_177500.1 | auxin efflux carrier component 1 [Arabidopsis thaliana] | 2.0e-23 | 93% |
RefSeq | Populus trichocarpa | XP_002322104.1 | auxin efflux carrier component [Populus trichocarpa] | 5.0e-22 | 91% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B5TXD0
Fln msg: Distance to subject end: 531 aas, your sequence is shorter than subject: 48 - 699
Fln protein:
N
Protein Length:
49
Fln nts:
A
Fln Alignment:
G5KS2UX02GX6SB___AMYGNFSGDLMVQVVVLQCIIWYTLMLFMFEYRGAKLLIMEQFPDT
B5TXD0_______________AMYGNFSGNLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPDT
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain