UniGene Name: sp_v3.0_unigene64395
Length: 182 nt
UniGene Fasta |
---|
>sp_v3.0_unigene64395
T |
Ace file of the UniGene sp_v3.0_unigene64395 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Pol protein integrase region (Fragment) n=1 Tax=Ginkgo biloba RepID=Q9ARL0_GINBI | - | - | 3.0e-15 | 90% |
FL-Next | tr=Putative uncharacterized protein; Vitis vinifera (Grape). | - | - | 0.0 | 66% |
Sma3 | Pol protein integrase region | - | - | 0.0 | - |
Source | Gene names |
---|---|
Sma3 | H0321H01.8; LOC_Os11g31050; LOC_Os11g45200; LOC_Os11g45920; MtrDRAFT_AC150244g37v2; OSJNBa0013A04.20; OSJNBa0026L12.26; OSJNBa0032F06.19; OSJNBa0054D14.1; OSJNBa0060B20.14; OSJNBa0065J03.2; OSJNBb0043H09.2; OSJNBb0062H02.17; OSJNBb0069N01.1; Os01g0790200; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | sequence-specific DNA binding | GO:0043565 | Molecular Function | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | apoptotic process | GO:0006915 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
Sma3 | Chromo domain/shadow | IPR000953 | - | 0.0 | - |
Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
Sma3 | Peptidase aspartic, active site | IPR001969 | - | 0.0 | - |
Sma3 | NB-ARC | IPR002182 | - | 0.0 | - |
Sma3 | DNA-binding WRKY | IPR003657 | - | 0.0 | - |
Sma3 | Retrotransposon gag protein | IPR005162 | - | 0.0 | - |
Sma3 | Retroviral aspartyl protease | IPR013242 | - | 0.0 | - |
Sma3 | Zinc finger, H2C2-type, histone UAS binding | IPR015416 | - | 0.0 | - |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: tr_plants
Fln subject: A5C0Y9
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 197 aas, your sequence is shorter than subject: 55 - 1258
Fln protein:
S
Protein Length:
56
Fln nts:
T
Fln Alignment:
G5KS2UX02GAS5N___VSDRDPIFTKIFWTELFSCLGTKLAHSSSYHPQSDGQTEIVN
A5C0Y9_______________VSDRDKVFLSLFWTKLFRLLGTSLCHSTAYHPQTDGQTEVVN
SSRs (tot: 1) |
---|
Start position | End position | Sequence | Length |
---|---|---|---|
154 | 168 | TTGAT TTGAT TTGAT | 15 |
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain