UniGene Name: sp_v3.0_unigene64341
Length: 116 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense) |
---|
>sp_v3.0_unigene64341
A |
Ace file of the UniGene sp_v3.0_unigene64341 (antisense) |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | phospholipid-transporting ATPase 3 [Arabidopsis thaliana] sp|Q9XIE6.2|ALA3_ARATH RecName: Full=Phospholipid-transporting ATPase 3; Short=AtALA3; AltName: Full=Aminophospholipid ATPase 3; AltName: Full=Aminophospholipid flippase 3; AltName: Full=Protein IR | - | - | 1.0e-09 | 86% |
FL-Next | sp=Phospholipid-transporting ATPase 3; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 86% |
Sma3 | Phospholipid-transporting ATPase, putative | - | - | 1.925e-07 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Phospholipid-translocating ATPase. | EC:3.6.3.1 | - | 1.432e-12 | - |
Source | Gene names |
---|---|
Sma3 | ALA2; ALA3; ALA8; At1g59820; At3g27870; CHLREDRAFT_190292; F23H11.14; GSVIVT00009008001; GSVIVT00020729001; K16N12.9; LOC_Os10g27220; MICPUCDRAFT_35603; MICPUN_84330; OSJNBb0011E04.123; OSTLU_49740; Os06g0488600; Os10g0412000; OsI_23030; OsI_29061; OsI_33 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Golgi apparatus | GO:0005794 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
Sma3 | phospholipid-translocating ATPase activity | GO:0004012 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism | GO:0015662 | Molecular Function | 0.0 | - |
Sma3 | ATP biosynthetic process | GO:0006754 | Biological Process | 0.0 | - |
Sma3 | phospholipid transport | GO:0015914 | Biological Process | 0.0 | - |
Sma3 | Golgi vesicle budding | GO:0048194 | Biological Process | 0.0 | - |
Sma3 | root development | GO:0048364 | Biological Process | 0.0 | - |
Sma3 | shoot development | GO:0048367 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | ATPase, P-type, K/Mg/Cd/Cu/Zn/Na/Ca/Na/H-transporter | IPR001757 | - | 0.0 | - |
Sma3 | Haloacid dehalogenase-like hydrolase | IPR005834 | - | 0.0 | - |
Sma3 | ATPase, P-type, phospholipid-translocating, flippase | IPR006539 | - | 0.0 | - |
Sma3 | ATPase, P-type, ATPase-associated domain | IPR008250 | - | 0.0 | - |
Sma3 | HAD superfamily hydrolase-like, type 3 | IPR013200 | - | 0.0 | - |
Sma3 | Aldehyde dehydrogenase, conserved site | IPR016160 | - | 0.0 | - |
Sma3 | ATPase, P-type phosphorylation site | IPR018303 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G59820.1 | ALA3 aminophospholipid ATPase 3 chr1:22011599-22020023 FORWARD LENGTH=1213 | 5.0e-14 | 86% |
RefSeq | Arabidopsis thaliana | NP_176191.1 | phospholipid-transporting ATPase 3 [Arabidopsis thaliana] | 6.0e-14 | 86% |
RefSeq | Populus trichocarpa | XP_002339708.1 | predicted protein, partial [Populus trichocarpa] | 7.0e-16 | 84% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9XIE6
Fln msg: Distance to subject end: 309 aas, your sequence is shorter than subject: 38 - 1213
Fln protein:
G
Protein Length:
39
Fln nts:
A
Fln Alignment:
G5KS2UX02GA9D8___GMQAVMASDFAISQFRFLTELLLVHGRLSYIRISKVV
Q9XIE6_______________GMQAVMASDFAIAQFRFLTDLLLVHGRWSYLRICKVV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain